Lus10043346 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46940 69 / 3e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G46930 69 / 7e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G46970 64 / 3e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G46960 62 / 2e-12 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G46950 59 / 1e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G38610 60 / 2e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G02250 48 / 3e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17220 47 / 9e-07 ATPMEI2 pectin methylesterase inhibitor 2 (.1)
AT5G46980 40 / 0.0001 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 39 / 0.0003 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019498 263 / 4e-91 AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10040119 103 / 3e-27 AT5G46930 98 / 2e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10030926 61 / 2e-12 AT5G46930 58 / 2e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10001464 57 / 3e-10 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10008201 55 / 1e-09 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10041650 54 / 2e-09 AT1G48020 85 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
Lus10017345 54 / 3e-09 AT3G17220 89 / 1e-22 pectin methylesterase inhibitor 2 (.1)
Lus10020664 50 / 5e-08 AT5G64620 67 / 2e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10001658 49 / 2e-07 AT1G48020 86 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G044100 145 / 7e-45 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G086500 102 / 1e-27 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G086600 90 / 7e-23 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.006G134900 61 / 5e-12 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.008G102600 59 / 4e-11 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.004G016500 42 / 3e-05 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G109700 39 / 0.0004 AT1G47960 46 / 2e-06 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10043346 pacid=23168231 polypeptide=Lus10043346 locus=Lus10043346.g ID=Lus10043346.BGIv1.0 annot-version=v1.0
ATGAAATCTGCCAACACCGATCCAAACATCTCCTACGACTTCTGCCTAACTCCCCTTCAAGCAGCCACCCATCCAGGATCCGACCCCGATCTCACCAAGC
TAGCCGTCATCTCCATAAACTTGATCCACCACAATGCCACCAACACCAAGTGCTTCATCAACCACCTCCTCTCCGACCACGACAACGCTAATTCCATGAC
AGACCCTTACGTCCAGGCATGCTTACAGGACTGCCTTCAGCTCTACTCCGACACCATACCTTCCCTCAAACCGGCCATCATAAGCATCAAGTACGGGAGC
TTCATGGATGCCAACATCAAGGTGGGTTTGGTTCTCGATGCATCTGCAACTTGCGAAGACCAGTTTGTCAACAGACCGGAGGACTCCGTCTCCCCGCTAA
CGACTAGAAACAGGGACAGATTTCAGCTGTGTGCAATCTCTCTATCCATCATCAACCTGCTCCGTATAGGCTGA
AA sequence
>Lus10043346 pacid=23168231 polypeptide=Lus10043346 locus=Lus10043346.g ID=Lus10043346.BGIv1.0 annot-version=v1.0
MKSANTDPNISYDFCLTPLQAATHPGSDPDLTKLAVISINLIHHNATNTKCFINHLLSDHDNANSMTDPYVQACLQDCLQLYSDTIPSLKPAIISIKYGS
FMDANIKVGLVLDASATCEDQFVNRPEDSVSPLTTRNRDRFQLCAISLSIINLLRIG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G46940 Plant invertase/pectin methyle... Lus10043346 0 1
AT5G60740 ABCG28 ATP-binding cassette G28, ABC ... Lus10016115 4.4 0.7698
AT5G16990 Zinc-binding dehydrogenase fam... Lus10030085 13.6 0.7477
AT5G23260 MADS ABS, TT16, AGL3... TRANSPARENT TESTA16, AGAMOUS-l... Lus10017388 15.2 0.7261
Lus10013984 18.7 0.6786
Lus10013687 19.0 0.6911
AT5G16920 Fasciclin-like arabinogalactan... Lus10013786 19.8 0.7390
AT1G79400 ATCHX2 cation/H+ exchanger 2, cation/... Lus10026156 20.0 0.7468
AT1G49170 Protein of unknown function (D... Lus10042819 22.0 0.7376
AT5G58170 GDPDL7, SVL5 Glycerophosphodiester phosphod... Lus10040036 29.2 0.7281
AT4G25300 2-oxoglutarate (2OG) and Fe(II... Lus10040106 31.7 0.6939

Lus10043346 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.