Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44620 187 / 1e-62 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1) AT1G65290 133 / 2e-41 MTACP2 mitochondrial acyl carrier protein 2 (.1) AT5G47630 80 / 2e-20 MTACP3 mitochondrial acyl carrier protein 3 (.1.2) AT3G05020 58 / 1e-11 ACP1 acyl carrier protein 1 (.1) AT5G27200 53 / 7e-10 ACP5 acyl carrier protein 5 (.1) AT1G54630 46 / 4e-07 ACP3 acyl carrier protein 3 (.1.2) AT1G54580 46 / 5e-07 ACP2 acyl carrier protein 2 (.1) AT4G25050 45 / 8e-07 ACP4 acyl carrier protein 4 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019500 [exp] 244 / 3e-85 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10020221 [exp] 126 / 1e-38 AT1G65290 183 / 4e-61 mitochondrial acyl carrier protein 2 (.1) Lus10026849 [exp] 128 / 1e-35 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3) Lus10038782 [exp] 78 / 2e-19 AT5G47630 112 / 6e-33 mitochondrial acyl carrier protein 3 (.1.2) Lus10000050 [exp] 76 / 8e-19 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2) Lus10039077 [exp] 76 / 8e-19 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2) Lus10033836 [exp] 52 / 2e-09 AT4G25050 137 / 2e-42 acyl carrier protein 4 (.1.2) Lus10018986 [exp] 52 / 3e-09 AT4G25050 136 / 3e-42 acyl carrier protein 4 (.1.2) Lus10037908 [exp] 49 / 5e-08 AT4G25050 132 / 8e-41 acyl carrier protein 4 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G044000 [exp] 192 / 1e-64 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1) Potri.002G135600 [exp] 176 / 1e-58 AT2G44620 177 / 1e-58 mitochondrial acyl carrier protein 1 (.1) Potri.019G055300 [exp] 135 / 6e-42 AT1G65290 196 / 6e-66 mitochondrial acyl carrier protein 2 (.1) Potri.013G084500 [exp] 127 / 4e-39 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1) Potri.016G006300 [exp] 82 / 4e-21 AT5G47630 111 / 1e-32 mitochondrial acyl carrier protein 3 (.1.2) Potri.006G005700 [exp] 81 / 7e-21 AT5G47630 107 / 5e-31 mitochondrial acyl carrier protein 3 (.1.2) Potri.006G217800 [exp] 55 / 2e-10 AT1G54630 94 / 2e-25 acyl carrier protein 3 (.1.2) Potri.005G044800 [exp] 47 / 2e-07 AT5G27200 146 / 5e-46 acyl carrier protein 5 (.1) Potri.012G105300 [exp] 47 / 2e-07 AT4G25050 107 / 8e-31 acyl carrier protein 4 (.1.2) Potri.015G104500 [exp] 45 / 8e-07 AT4G25050 122 / 2e-36 acyl carrier protein 4 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0314 [flax] [poplar] PP-binding PF00550 [flax] [poplar] PP-binding Phosphopantetheine attachment site
Representative CDS sequence Show only first row Show all	>Lus10043348 pacid=23168069 polypeptide=Lus10043348 locus=Lus10043348.g ID=Lus10043348.BGIv1.0 annot-version=v1.0 ATGGCGTTGAGGGCAGCCATCATCCGACACCTTCGTGTTCCCGTCCAAACCCTAGTTCCCGCTGGCCGATACACTCAGCCGTTCATCCGGCGAATGTCAT CGCACGACGACCATCTTAGCAAGGAAGACGTCGCCGAGAGAGTTCTTTCCGTCATCAAGAGCTTCCCGAAAGTCGATCCATCCAAGGTGACTCCTGAGGT ACATTTCCAAAATGATCTAGGATTGGACAGCCTGGACAGTGTTGAGATCGTGATGGCTTTGGAAGAGGAATTCAAGCTGGAGATTCCCGACAAGGAAGCT GATAAGATTGACTCGTGCAAGCTTGCTATCGAATACATCCATAACCATCCTATGGCAAGTTGA
AA sequence Show only first row Show all	>Lus10043348 pacid=23168069 polypeptide=Lus10043348 locus=Lus10043348.g ID=Lus10043348.BGIv1.0 annot-version=v1.0 MALRAAIIRHLRVPVQTLVPAGRYTQPFIRRMSSHDDHLSKEDVAERVLSVIKSFPKVDPSKVTPEVHFQNDLGLDSLDSVEIVMALEEEFKLEIPDKEA DKIDSCKLAIEYIHNHPMAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Lus10043348 [exp]	0	1
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Lus10019500 [exp]	1.0	0.9343
AT3G62810			complex 1 family protein / LVR...		Lus10021599 [exp]	2.0	0.8331
AT2G28430			unknown protein		Lus10022580 [exp]	3.5	0.8253
AT2G19740			Ribosomal protein L31e family ...		Lus10042028 [exp]	4.7	0.8731
AT2G20450			Ribosomal protein L14 (.1)		Lus10024918 [exp]	7.3	0.8353
AT5G02960			Ribosomal protein S12/S23 fami...		Lus10023172 [exp]	8.7	0.8290
AT2G09990			Ribosomal protein S5 domain 2-...		Lus10038012 [exp]	9.9	0.8052
AT1G26750			unknown protein		Lus10016383 [exp]	15.6	0.7931
AT3G53740			Ribosomal protein L36e family ...		Lus10016501 [exp]	15.9	0.8199
AT1G26880			Ribosomal protein L34e superfa...		Lus10036750 [exp]	17.7	0.8071

Compare expression of checked genes

Lus10043348 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.