Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019512 [exp] 58 / 5e-12 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G178900 [exp] 38 / 0.0004 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03760 [flax] [poplar] LEA_1 Late embryogenesis abundant (LEA) group 1
Representative CDS sequence Show only first row Show all	>Lus10043356 pacid=23167917 polypeptide=Lus10043356 locus=Lus10043356.g ID=Lus10043356.BGIv1.0 annot-version=v1.0 ATGCAGGCTGTGAAAGAGAAGATCCAGGACATGAAAGAGATGCGCAAGGTCAAGGCTGAAGCCAAGGCCGAAGAGAAGGCGGAGAAGGAGGTTGCAAAGG CGAGGATGGAGGTTGCGAAAGAGGTGAGGATGGCAAGAGAAGCTCAAGCAGAAATGCAACTCCATGCATCTAAAGCTGGCGAAAAGACCGTCGCCAAAAC TCCTTTAGACGCGGCCGGAGCACCGGCCACCACCCGAAACACCACCCGCACCACCACCACCCCCCCCCCCCCCCCCCCCCCCACCACTGACAGAACTTCT GCATAA
AA sequence Show only first row Show all	>Lus10043356 pacid=23167917 polypeptide=Lus10043356 locus=Lus10043356.g ID=Lus10043356.BGIv1.0 annot-version=v1.0 MQAVKEKIQDMKEMRKVKAEAKAEEKAEKEVAKARMEVAKEVRMAREAQAEMQLHASKAGEKTVAKTPLDAAGAPATTRNTTRTTTTPPPPPPPTTDRTS A

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G35300		AtLEA4-2, LEA18	late embryogenesis abundant 18...		Lus10043356 [exp]	0	1
AT3G44590			60S acidic ribosomal protein f...		Lus10026714 [exp]	16.0	0.8063
					Lus10022970 [exp]	80.6	0.7054
AT5G04220		SYT3, NTMCTYPE1...	synaptotagmin 3, Calcium-depen...		Lus10013802 [exp]	110.8	0.7151
AT5G42785			unknown protein		Lus10001961 [exp]	116.3	0.7198
AT4G08850			Leucine-rich repeat receptor-l...		Lus10031738 [exp]	123.5	0.6721
AT4G33880	bHLH	RSL2, bHLH085	ROOT HAIR DEFECTIVE 6-LIKE 2 (...		Lus10001068 [exp]	142.9	0.6890
AT5G14030			translocon-associated protein ...		Lus10035166 [exp]	194.6	0.6753
AT3G47340		AT-ASN1, DIN6, ...	DARK INDUCIBLE 6, ARABIDOPSIS ...		Lus10026376 [exp]	201.6	0.6840
AT2G02990		RNS1, ATRNS1	ribonuclease 1 (.1)		Lus10012823 [exp]	232.2	0.6786
AT3G51990			Protein kinase superfamily pro...		Lus10015478 [exp]	241.7	0.6675

Compare expression of checked genes

Lus10043356 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.