Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G54980 91 / 2e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G39230 87 / 4e-21 LOJ LATERAL ORGAN JUNCTION (.1) AT4G19890 55 / 8e-10 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G22470 54 / 2e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G62370 53 / 4e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G06920 52 / 1e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G31840 50 / 4e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT5G01110 49 / 9e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G59900 49 / 1e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G16640 49 / 1e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019524 [exp] 211 / 3e-65 AT3G54980 716 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10000364 [exp] 53 / 6e-09 AT1G22960 619 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10026545 [exp] 50 / 3e-08 AT2G17140 1002 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013832 [exp] 50 / 4e-08 AT2G17140 1034 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10023863 [exp] 49 / 8e-08 AT5G12100 728 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10025533 [exp] 49 / 1e-07 AT1G06710 980 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027974 [exp] 49 / 1e-07 AT1G19290 480 / 1e-156 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10043417 [exp] 49 / 1e-07 AT3G06920 1358 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10026791 [exp] 48 / 2e-07 AT1G52620 741 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G250700 [exp] 99 / 4e-25 AT3G54980 781 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G257300 [exp] 58 / 8e-11 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G271400 [exp] 57 / 2e-10 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G271200 [exp] 56 / 5e-10 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G264800 [exp] 53 / 3e-09 AT4G31850 1428 / 0.0 proton gradient regulation 3 (.1) Potri.002G183100 [exp] 53 / 4e-09 AT4G01570 1023 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.009G069600 [exp] 53 / 4e-09 AT4G28010 661 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.008G017400 [exp] 53 / 4e-09 AT5G04810 1278 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.002G182900 [exp] 52 / 6e-09 AT4G01570 1045 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G242200 [exp] 52 / 7e-09 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10043367 pacid=23168125 polypeptide=Lus10043367 locus=Lus10043367.g ID=Lus10043367.BGIv1.0 annot-version=v1.0 ATGGTGGATCAGGGCATTATTCCCTCTCTGCCTTTTGTGAACAGAGTCTTACGTGAATTGGTTAAAAGTCATTTGTTCCCTGAAGCTCAAGACCTCTACA GTAAGATGGTTGAGACAGACGCGAAAGGGGATGGTGTAACAGTTAAAATTATGATGCGTAGCTACGTGAAGCAAGGGAGAGATGCTAAAGCCAACGAGTT GTTTTTTAAGGCAAAAAACACAGGGATTGAACTTGATGCTGTGGCTTACACCATCCTCATTCAGGCTGTTTGCAGGATGCTTGATGGTAACTTAGCTTGT CAATTGTTGAGAGAGATGAAAAAACAAGGGATGGGTTCCGTCTGA
AA sequence Show only first row Show all	>Lus10043367 pacid=23168125 polypeptide=Lus10043367 locus=Lus10043367.g ID=Lus10043367.BGIv1.0 annot-version=v1.0 MVDQGIIPSLPFVNRVLRELVKSHLFPEAQDLYSKMVETDAKGDGVTVKIMMRSYVKQGRDAKANELFFKAKNTGIELDAVAYTILIQAVCRMLDGNLAC QLLREMKKQGMGSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G54980			Pentatricopeptide repeat (PPR)...		Lus10043367 [exp]	0	1
AT1G77170			Tetratricopeptide repeat (TPR)...		Lus10029884 [exp]	7.3	0.6454
AT1G01320			Tetratricopeptide repeat (TPR)...		Lus10020453 [exp]	7.6	0.6574
AT3G22470			Pentatricopeptide repeat (PPR)...		Lus10003426 [exp]	26.7	0.6465
AT3G49142			Tetratricopeptide repeat (TPR)...		Lus10027561 [exp]	59.9	0.6068
AT1G07230		NPC1	non-specific phospholipase C1 ...		Lus10018228 [exp]	95.5	0.5771
AT1G13570			F-box/RNI-like superfamily pro...		Lus10016472 [exp]	95.7	0.5486
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Lus10009201 [exp]	96.5	0.5768
AT5G19120			Eukaryotic aspartyl protease f...		Lus10041004 [exp]	132.0	0.5287
AT2G34930			disease resistance family prot...		Lus10016337 [exp]	139.4	0.5468
AT2G37890			Mitochondrial substrate carrie...		Lus10016523 [exp]	145.5	0.5422

Compare expression of checked genes

Lus10043367 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.