Lus10043370 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G18010 103 / 2e-26 Major facilitator superfamily protein (.1)
AT1G18000 103 / 2e-26 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019527 119 / 8e-32 AT1G18010 578 / 0.0 Major facilitator superfamily protein (.1)
Lus10009416 97 / 1e-24 AT1G18010 405 / 1e-140 Major facilitator superfamily protein (.1)
Lus10043371 99 / 3e-24 AT1G18010 657 / 0.0 Major facilitator superfamily protein (.1)
Lus10020560 97 / 9e-24 AT1G18010 573 / 0.0 Major facilitator superfamily protein (.1)
Lus10019528 96 / 1e-23 AT1G18010 659 / 0.0 Major facilitator superfamily protein (.1)
Lus10006288 95 / 5e-23 AT1G18010 649 / 0.0 Major facilitator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G005100 104 / 2e-26 AT1G18010 630 / 0.0 Major facilitator superfamily protein (.1)
Potri.012G011000 82 / 2e-18 AT1G18010 422 / 5e-146 Major facilitator superfamily protein (.1)
Potri.009G148400 38 / 0.0005 AT2G27775 56 / 1e-11 unknown protein
PFAM info
Representative CDS sequence
>Lus10043370 pacid=23168313 polypeptide=Lus10043370 locus=Lus10043370.g ID=Lus10043370.BGIv1.0 annot-version=v1.0
ATGATCTATTGGGTGACTGGTGCCTTGGCGGATGATACTGAGACTCTGAGCAGGTACGCTGGGTTCTACAAAGGGATGCAGAGTGCAGGAGCTGCGGTGG
CTTGGCAGCTTGATGCTAGGAAAGTTCCGATGCTGACGCAGTTGGTTGTGAACTGGTCGCTTACAACGATAAAAGTTATAGCAAGAAGTGTATGTGGAAA
GAACCTTCAGAGGAGGAACAATCTAAAGAGGGAAGCTTGGAGACAAGGCAAGCTGAAGCAGTGGCACTGTGGAAGGGCAGAAGTGAGCTCAATTCTCGTC
GTAAAACCATCCTGCCGATATGACCAATGCGCACAATTATTTGTGGTTGTCCCATTCAAACGAGAAACAAAATACAGCCATGCAACTAAAAAAGGAACAG
CTTTAATGGGAAAAAAGGAGAGCAAAGGCAACCTTGGAGAAGAAGGTGAAGATGGAGAAACACGTAGAGTGGCGTTAGGGAGAATTGAGGGAGGCATAGA
AATGCTTTTGCTTCTGATTGTTGATTGA
AA sequence
>Lus10043370 pacid=23168313 polypeptide=Lus10043370 locus=Lus10043370.g ID=Lus10043370.BGIv1.0 annot-version=v1.0
MIYWVTGALADDTETLSRYAGFYKGMQSAGAAVAWQLDARKVPMLTQLVVNWSLTTIKVIARSVCGKNLQRRNNLKREAWRQGKLKQWHCGRAEVSSILV
VKPSCRYDQCAQLFVVVPFKRETKYSHATKKGTALMGKKESKGNLGEEGEDGETRRVALGRIEGGIEMLLLLIVD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G18010 Major facilitator superfamily ... Lus10043370 0 1
AT1G30690 Sec14p-like phosphatidylinosit... Lus10031176 1.4 0.9287
AT5G10250 DOT3 DEFECTIVELY ORGANIZED TRIBUTAR... Lus10026046 2.0 0.9058
AT4G25300 2-oxoglutarate (2OG) and Fe(II... Lus10040106 2.8 0.8508
AT3G10530 Transducin/WD40 repeat-like su... Lus10032289 3.0 0.8409
AT1G26480 GF14IOTA, GRF12 general regulatory factor 12 (... Lus10037089 3.9 0.8972
AT1G67120 ATPases;nucleotide binding;ATP... Lus10037615 5.9 0.8650
AT3G13860 HSP60-3A heat shock protein 60-3A (.1) Lus10003791 6.8 0.8103
AT1G30690 Sec14p-like phosphatidylinosit... Lus10031175 7.5 0.8578
Lus10033476 7.7 0.8665
AT3G51710 D-mannose binding lectin prote... Lus10009088 7.9 0.7994

Lus10043370 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.