Lus10043374 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44480 50 / 1e-08 BGLU17 beta glucosidase 17 (.1.2)
AT3G60130 40 / 6e-05 BGLU16 beta glucosidase 16 (.1.2.3)
AT5G44640 38 / 0.0003 BGLU13 beta glucosidase 13 (.1)
AT5G42260 38 / 0.0003 BGLU12 beta glucosidase 12 (.1)
AT1G47600 37 / 0.0008 BGLU34, TGG4 THIOGLUCOSIDE GLUCOHYDROLASE 4, beta glucosidase 34 (.1.2)
AT5G48375 37 / 0.001 BGLU39, TGG3 BETA GLUCOSIDASE 39, thioglucoside glucosidase 3 (.1)
AT2G44450 37 / 0.001 BGLU15 beta glucosidase 15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019531 106 / 3e-28 AT2G44480 597 / 0.0 beta glucosidase 17 (.1.2)
Lus10031234 59 / 2e-11 AT2G44480 563 / 0.0 beta glucosidase 17 (.1.2)
Lus10031808 59 / 2e-11 AT2G44480 560 / 0.0 beta glucosidase 17 (.1.2)
Lus10003915 53 / 3e-09 AT2G44480 617 / 0.0 beta glucosidase 17 (.1.2)
Lus10037473 51 / 7e-09 AT2G44480 590 / 0.0 beta glucosidase 17 (.1.2)
Lus10012687 46 / 6e-07 AT2G44480 525 / 0.0 beta glucosidase 17 (.1.2)
Lus10031235 46 / 6e-07 AT2G44450 590 / 0.0 beta glucosidase 15 (.1)
Lus10011828 44 / 4e-06 AT2G44480 438 / 4e-146 beta glucosidase 17 (.1.2)
Lus10039513 41 / 4e-05 AT2G44480 472 / 3e-162 beta glucosidase 17 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G227300 74 / 5e-17 AT2G44480 585 / 0.0 beta glucosidase 17 (.1.2)
Potri.001G227400 74 / 6e-17 AT2G44480 513 / 3e-180 beta glucosidase 17 (.1.2)
Potri.003G211100 60 / 5e-12 AT5G44640 569 / 0.0 beta glucosidase 13 (.1)
Potri.T085301 60 / 5e-12 AT5G44640 575 / 0.0 beta glucosidase 13 (.1)
Potri.001G227200 58 / 3e-11 AT2G44480 614 / 0.0 beta glucosidase 17 (.1.2)
Potri.004G040700 44 / 3e-06 AT5G44640 548 / 0.0 beta glucosidase 13 (.1)
Potri.001G223900 42 / 2e-05 AT2G44480 526 / 0.0 beta glucosidase 17 (.1.2)
Potri.001G223500 41 / 2e-05 AT2G44480 526 / 0.0 beta glucosidase 17 (.1.2)
Potri.001G223800 41 / 2e-05 AT2G44480 527 / 0.0 beta glucosidase 17 (.1.2)
Potri.001G224000 41 / 2e-05 AT3G60120 526 / 0.0 beta glucosidase 27 (.1)
PFAM info
Representative CDS sequence
>Lus10043374 pacid=23168071 polypeptide=Lus10043374 locus=Lus10043374.g ID=Lus10043374.BGIv1.0 annot-version=v1.0
ATGTCTTCTTCTCGGATTATCTTCCTTTCTTCTTGCTTTCTTGGCCATAGACTCTCCCAACTTCAGTGCAAAACAGTCGAAGATGTTGACCGGGTCTTTG
GATTCCACGGGGTCAACTACTACACTACAAACTTCGCCGCCGACAATCCTGTTCTTCACGGTCCCAACACCAGTTACTCTATCGACTCCCAAGCTCTTTT
CACAACTTCCAAGGCTGGAGTTCCAATCGGTACGCCGTACAAGAACCCACCAATCTACATCACTGACAATGGTAATTAA
AA sequence
>Lus10043374 pacid=23168071 polypeptide=Lus10043374 locus=Lus10043374.g ID=Lus10043374.BGIv1.0 annot-version=v1.0
MSSSRIIFLSSCFLGHRLSQLQCKTVEDVDRVFGFHGVNYYTTNFAADNPVLHGPNTSYSIDSQALFTTSKAGVPIGTPYKNPPIYITDNGN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Lus10043374 0 1

Lus10043374 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.