Lus10043392 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034192 59 / 7e-12 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10043392 pacid=23168090 polypeptide=Lus10043392 locus=Lus10043392.g ID=Lus10043392.BGIv1.0 annot-version=v1.0
ATGATTGGTTGGCGAGACAGTGAGAGGAAACCGAGTAGCAGGGACGCCATTTTCAACTTCACACTGCAGCTTCATCATCACCCAGTCAGTCTCTCCCGCA
ACCATTCAATTCTTGCACCAAGAAAGTTATCTTTGCCGTCGATCAAGACTGAATCACTCTCCTCCGTCAACAAGCGTGGCGGTGGGGGTGGGAGCCGTGG
AGGCCACAGCAGCAGCGGGAAGGGTGGAAGAGGCTTGAAAGGAAAAGGAACAAGTGGACGAGGAAGAGCAATTCCAGTATATGCTGGCGGAGCTGCTGCT
GCTGGATCTAACGGTCACCACCGCAATGGCGCAGTCCTGATCAATCCTGGGAAGGCCAATCTTGGTCTTTCAATGCTGGTTCTTGCCATCACACTCTTCA
AGTATTTTCTTGCATGTTAG
AA sequence
>Lus10043392 pacid=23168090 polypeptide=Lus10043392 locus=Lus10043392.g ID=Lus10043392.BGIv1.0 annot-version=v1.0
MIGWRDSERKPSSRDAIFNFTLQLHHHPVSLSRNHSILAPRKLSLPSIKTESLSSVNKRGGGGGSRGGHSSSGKGGRGLKGKGTSGRGRAIPVYAGGAAA
AGSNGHHRNGAVLINPGKANLGLSMLVLAITLFKYFLAC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10043392 0 1
AT2G23810 TET8 tetraspanin8 (.1) Lus10019965 2.0 0.9640
AT4G17230 GRAS SCL13 SCARECROW-like 13 (.1) Lus10017554 2.8 0.9624
AT4G17230 GRAS SCL13 SCARECROW-like 13 (.1) Lus10000539 4.5 0.9423
AT1G66420 GeBP DNA-binding storekeeper protei... Lus10017793 5.8 0.9074
AT1G80840 WRKY ATWRKY40, WRKY4... WRKY DNA-binding protein 40 (.... Lus10041660 5.9 0.9412
AT5G48150 GRAS PAT1 phytochrome a signal transduct... Lus10035840 6.5 0.9459
AT2G23810 TET8 tetraspanin8 (.1) Lus10015494 7.7 0.9411
AT1G80840 WRKY ATWRKY40, WRKY4... WRKY DNA-binding protein 40 (.... Lus10024074 8.0 0.9309
AT4G32030 unknown protein Lus10001935 8.0 0.9079
AT3G11760 unknown protein Lus10021254 8.1 0.9183

Lus10043392 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.