Lus10043393 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G18970 114 / 1e-31 GLP4 germin-like protein 4 (.1)
AT1G18980 106 / 1e-28 RmlC-like cupins superfamily protein (.1)
AT3G05950 104 / 7e-28 RmlC-like cupins superfamily protein (.1)
AT1G09560 103 / 1e-27 GLP5 germin-like protein 5 (.1)
AT3G04200 103 / 2e-27 RmlC-like cupins superfamily protein (.1)
AT3G04150 101 / 1e-26 RmlC-like cupins superfamily protein (.1.2)
AT5G38910 100 / 2e-26 RmlC-like cupins superfamily protein (.1)
AT1G02335 97 / 3e-25 GL22 germin-like protein subfamily 2 member 2 precursor (.1)
AT5G38960 97 / 4e-25 RmlC-like cupins superfamily protein (.1)
AT3G10080 96 / 2e-24 RmlC-like cupins superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034191 288 / 4e-100 AT1G18970 136 / 4e-40 germin-like protein 4 (.1)
Lus10004856 178 / 6e-57 AT1G02335 129 / 3e-37 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10020632 172 / 1e-54 AT1G02335 129 / 1e-37 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10004855 172 / 1e-54 AT1G02335 129 / 3e-37 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10004854 169 / 2e-53 AT1G02335 137 / 2e-40 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10020631 165 / 6e-52 AT3G10080 132 / 7e-39 RmlC-like cupins superfamily protein (.1)
Lus10004857 163 / 3e-51 AT1G02335 140 / 4e-42 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10004858 144 / 2e-43 AT1G02335 123 / 7e-35 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10035293 105 / 4e-28 AT5G39110 226 / 4e-75 RmlC-like cupins superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G194600 176 / 8e-56 AT3G62020 129 / 4e-37 germin-like protein 10 (.1.2)
Potri.009G157100 173 / 6e-55 AT1G09560 105 / 3e-28 germin-like protein 5 (.1)
Potri.008G016700 171 / 3e-54 AT1G18980 122 / 6e-35 RmlC-like cupins superfamily protein (.1)
Potri.010G240500 171 / 4e-54 AT3G04200 123 / 5e-35 RmlC-like cupins superfamily protein (.1)
Potri.010G240700 169 / 2e-53 AT1G02335 141 / 4e-42 germin-like protein subfamily 2 member 2 precursor (.1)
Potri.010G240600 164 / 2e-51 AT3G62020 112 / 3e-31 germin-like protein 10 (.1.2)
Potri.008G084300 161 / 3e-50 AT1G02335 147 / 3e-44 germin-like protein subfamily 2 member 2 precursor (.1)
Potri.013G116500 126 / 1e-36 AT1G18970 70 / 1e-14 germin-like protein 4 (.1)
Potri.011G163216 108 / 2e-29 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3)
Potri.011G163300 108 / 2e-29 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF00190 Cupin_1 Cupin
Representative CDS sequence
>Lus10043393 pacid=23168138 polypeptide=Lus10043393 locus=Lus10043393.g ID=Lus10043393.BGIv1.0 annot-version=v1.0
ATGGCCTCCTTAACAGCTGCTCATCTTCTCAAGCGATTTCATTCTCCCCGACAACCAACCGAGGTTGATGCATCGTTCTTCACTTACGCGGGAGCTCGAG
GCATTTTGGATTCAGACAACCCTCCTTCAAGTTTCACAGTAACAGAAGTGAGCATTACCGAGTTTCCTGCTCTTAATGGACAAGGTGTTTCCTATGCTGT
TCTTCAGTTACCAGCCGGATCTACTTATCCTCCTCACAGTCATCCTCGTGCTTCCGAGATCCTTCTAGTATTCCGTGGATGTGTTGAGGTAGGACTTGTC
GTAGCAAACAACTGTCTCTACAATCAGACACTATATGTGGGGGACATGTTTGTTTTTCCCAAGGGACTTGTTCATTTTGCATTCAACGGTGGGGATGAAG
CTGCTACTGCACTTTCTTCATTCAGCAGCGCGAGTCCAGGAACTGTTTCGCTTCCAGATTCGCTTTTCGCTAGCAACATCGGCGATGCCATCTTGGCTAG
TGCCTTCAAGACCAACGTGAACATCATTCAGGCCATTAAGGATGGTTTGCAGTACAATCATCCCCCGGAAGATGGATGA
AA sequence
>Lus10043393 pacid=23168138 polypeptide=Lus10043393 locus=Lus10043393.g ID=Lus10043393.BGIv1.0 annot-version=v1.0
MASLTAAHLLKRFHSPRQPTEVDASFFTYAGARGILDSDNPPSSFTVTEVSITEFPALNGQGVSYAVLQLPAGSTYPPHSHPRASEILLVFRGCVEVGLV
VANNCLYNQTLYVGDMFVFPKGLVHFAFNGGDEAATALSSFSSASPGTVSLPDSLFASNIGDAILASAFKTNVNIIQAIKDGLQYNHPPEDG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G18970 GLP4 germin-like protein 4 (.1) Lus10043393 0 1
AT5G48150 GRAS PAT1 phytochrome a signal transduct... Lus10036623 1.7 0.9281
AT5G54165 unknown protein Lus10023231 2.4 0.9260
AT5G47430 DWNN domain, a CCHC-type zinc ... Lus10034393 4.5 0.9014
AT1G76070 unknown protein Lus10021840 5.7 0.8921
AT3G16720 ATL2 TOXICOS EN LEVADURA 2 (.1) Lus10037490 6.0 0.8983
AT5G42120 Concanavalin A-like lectin pro... Lus10042795 6.5 0.8715
AT2G25770 Polyketide cyclase/dehydrase a... Lus10028262 6.9 0.8842
AT3G22970 Protein of unknown function (D... Lus10014718 8.1 0.8709
AT5G16080 ATCXE17 carboxyesterase 17 (.1) Lus10002907 8.5 0.9057
AT2G45760 BAL, BAP2 BON ASSOCIATION PROTEIN 1-LIKE... Lus10040924 9.7 0.8759

Lus10043393 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.