Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22280 105 / 7e-31 unknown protein AT3G44280 87 / 2e-23 unknown protein AT5G06265 56 / 3e-11 hyaluronan mediated motility receptor-related (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034182 [exp] 86 / 1e-23 AT5G22280 77 / 2e-20 unknown protein Lus10016983 [exp] 79 / 3e-20 AT5G22280 76 / 4e-19 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G200200 [exp] 139 / 2e-44 AT5G22280 101 / 3e-29 unknown protein Potri.006G206100 [exp] 100 / 1e-28 AT5G22280 72 / 2e-17 unknown protein Potri.016G073500 [exp] 93 / 4e-26 AT5G22280 93 / 7e-26 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043403 pacid=23168345 polypeptide=Lus10043403 locus=Lus10043403.g ID=Lus10043403.BGIv1.0 annot-version=v1.0 ATGTCGAGGCCTATGCTACTGGTCTTTCTGCTACTTATACTCATAATCACCTCTCAGTTTGAATGGAGACAACAACTTGTAAATGACATTGATCCTAGTC CAGCCATAACTGTTAAACAACAACAAATTTCAAAGAGAGAGGAAGCTGTCAAGGAGAAGATTATCCTGTCACAAGAGAAGAACATTCACAGGCTTAACGA GTTGGTTCGGAGCCTTCGGCAGCAATTGTCAGAATGCAGTTGCAGGAACGAAACAACCAATGCCGGTGCAAATAGTTTGACGGAGCATGTTATTGAACTC GAAAGACAGCAGTTTCTGGAGGATTAA
AA sequence Show only first row Show all	>Lus10043403 pacid=23168345 polypeptide=Lus10043403 locus=Lus10043403.g ID=Lus10043403.BGIv1.0 annot-version=v1.0 MSRPMLLVFLLLILIITSQFEWRQQLVNDIDPSPAITVKQQQISKREEAVKEKIILSQEKNIHRLNELVRSLRQQLSECSCRNETTNAGANSLTEHVIEL ERQQFLED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G22280			unknown protein		Lus10043403 [exp]	0	1
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10035118 [exp]	5.1	0.9260
					Lus10041954 [exp]	11.0	0.9058
AT1G28120			unknown protein		Lus10026630 [exp]	13.3	0.9199
AT3G61790			Protein with RING/U-box and TR...		Lus10004001 [exp]	13.9	0.9087
AT1G78310			VQ motif-containing protein (....		Lus10036480 [exp]	16.0	0.9008
AT1G68150	WRKY	ATWRKY9, WRKY9	WRKY DNA-binding protein 9 (.1...		Lus10016682 [exp]	16.2	0.9156
AT2G43970			RNA-binding protein (.1.2)		Lus10025608 [exp]	16.3	0.9002
AT3G10120			unknown protein		Lus10039676 [exp]	16.9	0.9092
AT4G14300			RNA-binding (RRM/RBD/RNP motif...		Lus10011783 [exp]	18.3	0.9111
AT5G51830			pfkB-like carbohydrate kinase ...		Lus10027401 [exp]	20.0	0.9123

Compare expression of checked genes

Lus10043403 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.