Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09800 215 / 2e-73 RPS18C S18 ribosomal protein (.1) AT1G34030 215 / 2e-73 Ribosomal protein S13/S18 family (.1) AT1G22780 215 / 2e-73 RPS18A, PFL1, PFL 40S RIBOSOMAL PROTEIN S18, POINTED FIRST LEAVES 1, POINTED FIRST LEAVES, Ribosomal protein S13/S18 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014676 [exp] 225 / 3e-77 AT1G34030 303 / 1e-107 Ribosomal protein S13/S18 family (.1) Lus10022057 [exp] 225 / 3e-77 AT4G09800 303 / 1e-107 S18 ribosomal protein (.1) Lus10042603 [exp] 224 / 8e-77 AT1G22780 304 / 5e-108 40S RIBOSOMAL PROTEIN S18, POINTED FIRST LEAVES 1, POINTED FIRST LEAVES, Ribosomal protein S13/S18 family (.1) Lus10006914 [exp] 224 / 8e-77 AT4G09800 304 / 5e-108 S18 ribosomal protein (.1) Lus10034179 [exp] 222 / 5e-76 AT1G34030 302 / 3e-107 Ribosomal protein S13/S18 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G211200 [exp] 223 / 3e-76 AT4G09800 276 / 7e-97 S18 ribosomal protein (.1) Potri.002G051300 [exp] 222 / 3e-76 AT4G09800 275 / 2e-96 S18 ribosomal protein (.1) Potri.005G196600 [exp] 216 / 7e-73 AT4G09800 278 / 2e-96 S18 ribosomal protein (.1) Potri.002G064632 [exp] 134 / 6e-42 AT4G09800 151 / 7e-49 S18 ribosomal protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0303 [flax] [poplar] H2TH PF00416 [flax] [poplar] Ribosomal_S13 Ribosomal protein S13/S18
Representative CDS sequence Show only first row Show all	>Lus10043405 pacid=23168155 polypeptide=Lus10043405 locus=Lus10043405.g ID=Lus10043405.BGIv1.0 annot-version=v1.0 ATGTTTGCCCTTACCTCCATCAAGGGTATCGGTCGCCGATTTGCCAACATAGTCTGCAAGAAGGCCGACGTCGACATGAACAAGAGTCGGGCTGGAGAGG TGTCATCCGAAGAGCTTGACAAGCTAATGACAGTGGTTGCTAACCCTCGTCAGTTCAAGATCCCAGACTGGTTCCTGAACAGGCAGAAGGATTACAAGGA TGGAAAGTATTCCCAAGTGGTCTCTAATGCAGTGGACATGAAGCTGAGGGACGATCTCGAGAGGCTCAAGAAGATCAGAAACCATCGCGGTCTGCGTCAC TACTGGGGTTTGAGAGTCCGCGGACAGCACACCAAGACCACCGGCCGTAGAGGGAAGACTGTTGGTGTGTCCAAGAAGCGATAA
AA sequence Show only first row Show all	>Lus10043405 pacid=23168155 polypeptide=Lus10043405 locus=Lus10043405.g ID=Lus10043405.BGIv1.0 annot-version=v1.0 MFALTSIKGIGRRFANIVCKKADVDMNKSRAGEVSSEELDKLMTVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNAVDMKLRDDLERLKKIRNHRGLRH YWGLRVRGQHTKTTGRRGKTVGVSKKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10043405 [exp]	0	1
AT1G74270			Ribosomal protein L35Ae family...		Lus10035539 [exp]	1.0	0.8643
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10019881 [exp]	4.2	0.8642
AT2G03510			SPFH/Band 7/PHB domain-contain...		Lus10004648 [exp]	5.7	0.8513
AT4G15000			Ribosomal L27e protein family ...		Lus10027314 [exp]	6.2	0.8539
AT1G18800		NRP2	NAP1-related protein 2 (.1)		Lus10024229 [exp]	6.7	0.8099
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Lus10027926 [exp]	6.7	0.8493
AT4G22380			Ribosomal protein L7Ae/L30e/S1...		Lus10017031 [exp]	6.9	0.8407
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Lus10033907 [exp]	7.3	0.8304
AT1G47278			unknown protein		Lus10016567 [exp]	8.1	0.7969
AT5G41685			Mitochondrial outer membrane t...		Lus10016473 [exp]	9.8	0.7825

Compare expression of checked genes

Lus10043405 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.