Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22210 45 / 3e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G162200 [exp] 84 / 2e-23 AT5G22210 91 / 3e-25 unknown protein Potri.004G201000 [exp] 82 / 8e-23 AT5G22210 84 / 7e-23 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043407 pacid=23168350 polypeptide=Lus10043407 locus=Lus10043407.g ID=Lus10043407.BGIv1.0 annot-version=v1.0 ATGCGCGACCTTGCGAGGATTCATGGTTTTAAACCCGACAATGTTGATGCTGTGAAGCCACCAGACCATTATGTCGAGTACATGAAGTTACACATACATG GATGGTTGGATGTTAATCTGGACGATCCTGATTTAGCTCATCTGTTTCCAGGCAAGTAA
AA sequence Show only first row Show all	>Lus10043407 pacid=23168350 polypeptide=Lus10043407 locus=Lus10043407.g ID=Lus10043407.BGIv1.0 annot-version=v1.0 MRDLARIHGFKPDNVDAVKPPDHYVEYMKLHIHGWLDVNLDDPDLAHLFPGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G22210			unknown protein		Lus10043407 [exp]	0	1
AT3G51530			F-box/RNI-like/FBD-like domain...		Lus10003696 [exp]	2.6	0.7784
					Lus10025367 [exp]	8.8	0.7586
AT1G15330		AtPV42a	Cystathionine beta-synthase (C...		Lus10004227 [exp]	8.9	0.8429
AT2G38500			2-oxoglutarate (2OG) and Fe(II...		Lus10025240 [exp]	11.6	0.7805
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10037633 [exp]	18.4	0.7717
					Lus10000529 [exp]	19.3	0.7717
AT2G04865			Aminotransferase-like, plant m...		Lus10014633 [exp]	20.2	0.7717
					Lus10008001 [exp]	21.0	0.7717
AT2G36190		ATCWINV4	cell wall invertase 4 (.1)		Lus10017015 [exp]	21.8	0.7717
AT3G60730			Plant invertase/pectin methyle...		Lus10015877 [exp]	22.6	0.7717

Compare expression of checked genes

Lus10043407 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.