Lus10043422 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G31740 141 / 2e-40 BGAL15 beta-galactosidase 15 (.1)
AT5G20710 133 / 2e-37 BGAL7 beta-galactosidase 7 (.1)
AT3G13750 125 / 1e-34 BGAL1 beta-galactosidase 1, beta galactosidase 1 (.1)
AT2G28470 120 / 6e-33 BGAL8 beta-galactosidase 8 (.1.2)
AT5G63800 120 / 8e-33 MUM2, BGAL6 MUCILAGE-MODIFIED 2, beta-galactosidase 6, Glycosyl hydrolase family 35 protein (.1)
AT5G56870 115 / 4e-31 BGAL4 beta-galactosidase 4 (.1)
AT1G77410 115 / 5e-31 BGAL16 beta-galactosidase 16 (.1)
AT4G26140 114 / 1e-30 BGAL12 beta-galactosidase 12 (.1.2)
AT3G52840 112 / 3e-30 BGAL2 beta-galactosidase 2 (.1)
AT1G45130 110 / 1e-29 BGAL5 beta-galactosidase 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011237 120 / 4e-33 AT2G28470 901 / 0.0 beta-galactosidase 8 (.1.2)
Lus10006733 120 / 5e-33 AT2G28470 939 / 0.0 beta-galactosidase 8 (.1.2)
Lus10020875 119 / 1e-32 AT5G63800 785 / 0.0 MUCILAGE-MODIFIED 2, beta-galactosidase 6, Glycosyl hydrolase family 35 protein (.1)
Lus10015625 118 / 4e-32 AT3G13750 1417 / 0.0 beta-galactosidase 1, beta galactosidase 1 (.1)
Lus10037644 118 / 5e-32 AT3G13750 1432 / 0.0 beta-galactosidase 1, beta galactosidase 1 (.1)
Lus10020877 117 / 6e-32 AT2G16730 733 / 0.0 beta-galactosidase 13, glycosyl hydrolase family 35 protein (.1)
Lus10000701 117 / 9e-32 AT3G13750 1481 / 0.0 beta-galactosidase 1, beta galactosidase 1 (.1)
Lus10018138 117 / 1e-31 AT1G77410 928 / 0.0 beta-galactosidase 16 (.1)
Lus10033502 117 / 1e-31 AT5G63800 844 / 0.0 MUCILAGE-MODIFIED 2, beta-galactosidase 6, Glycosyl hydrolase family 35 protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G025701 132 / 2e-37 AT5G20710 1123 / 0.0 beta-galactosidase 7 (.1)
Potri.001G025800 129 / 6e-36 AT5G20710 1097 / 0.0 beta-galactosidase 7 (.1)
Potri.001G200400 121 / 2e-33 AT3G13750 1471 / 0.0 beta-galactosidase 1, beta galactosidase 1 (.1)
Potri.003G038500 120 / 6e-33 AT3G13750 1484 / 0.0 beta-galactosidase 1, beta galactosidase 1 (.1)
Potri.011G044300 116 / 1e-31 AT2G28470 993 / 0.0 beta-galactosidase 8 (.1.2)
Potri.005G069200 116 / 2e-31 AT5G63800 962 / 0.0 MUCILAGE-MODIFIED 2, beta-galactosidase 6, Glycosyl hydrolase family 35 protein (.1)
Potri.009G012400 116 / 2e-31 AT2G28470 1281 / 0.0 beta-galactosidase 8 (.1.2)
Potri.013G105100 115 / 2e-31 AT1G77410 1053 / 0.0 beta-galactosidase 16 (.1)
Potri.002G080700 113 / 1e-30 AT1G77410 1115 / 0.0 beta-galactosidase 16 (.1)
Potri.005G232600 112 / 3e-30 AT4G36360 1332 / 0.0 beta-galactosidase 3 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF01301 Glyco_hydro_35 Glycosyl hydrolases family 35
Representative CDS sequence
>Lus10043422 pacid=23168351 polypeptide=Lus10043422 locus=Lus10043422.g ID=Lus10043422.BGIv1.0 annot-version=v1.0
ATGGCTTCTACAGCAGCAATAGCACTCTCACAAAAGTTATCTCTATTGTTCCTCCTAGTCTTATGTGCTTCCTGTGTAATATTGTCTTCCGCCACAACCG
TGTCCCGCGACGGTCGAGCAATCACCATCGATGGCAAACGCAGAGTCCTCCTCTCTGGCTCAGTCCATTACCCACGAAGCACCCCGCAAATGTGGCCGGA
GCTGATTTCGAAAGCCGAGGAAGGAGGGATTGATGTGATAGAGACGTACGTGTTCTGGAATGCGCACGAGCCAAGTCGTCGGCAGTACGATTTCAGTGGT
AATCTGGATTTGATAAGTTACTAA
AA sequence
>Lus10043422 pacid=23168351 polypeptide=Lus10043422 locus=Lus10043422.g ID=Lus10043422.BGIv1.0 annot-version=v1.0
MASTAAIALSQKLSLLFLLVLCASCVILSSATTVSRDGRAITIDGKRRVLLSGSVHYPRSTPQMWPELISKAEEGGIDVIETYVFWNAHEPSRRQYDFSG
NLDLISY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G31740 BGAL15 beta-galactosidase 15 (.1) Lus10043422 0 1
AT5G59320 LTP3 lipid transfer protein 3 (.1) Lus10026418 1.4 0.9415
AT3G52740 unknown protein Lus10014197 2.8 0.9242
Lus10037540 3.2 0.9059
AT2G26910 PEC1, ABCG32, P... PERMEABLE CUTICLE 1, ATP-bindi... Lus10043305 4.0 0.8937
AT1G78955 CAMS1 camelliol C synthase 1 (.1) Lus10016442 6.2 0.8778
AT2G20870 cell wall protein precursor, p... Lus10018569 7.2 0.9070
AT1G11600 CYP77B1 "cytochrome P450, family 77, s... Lus10007659 7.3 0.8886
AT2G04570 GDSL-like Lipase/Acylhydrolase... Lus10015162 7.9 0.9144
AT5G50790 SWEET10, AtSWEE... Nodulin MtN3 family protein (.... Lus10008861 8.8 0.8958
AT5G56170 LLG1 LORELEI-LIKE-GPI-ANCHORED PROT... Lus10010587 9.2 0.8466

Lus10043422 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.