Lus10043430 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27510 174 / 2e-56 ATFD3 ferredoxin 3 (.1)
AT1G60950 144 / 1e-44 FED A, ATFD2, FEDA FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
AT5G10000 141 / 2e-43 ATFD4 ferredoxin 4 (.1)
AT1G10960 132 / 4e-40 ATFD1 ferredoxin 1 (.1)
AT4G14890 84 / 4e-21 FdC2 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
AT1G32550 79 / 8e-19 FdC1 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034144 271 / 9e-95 AT2G27510 179 / 1e-58 ferredoxin 3 (.1)
Lus10020616 167 / 6e-54 AT2G27510 172 / 9e-56 ferredoxin 3 (.1)
Lus10004870 166 / 2e-53 AT2G27510 165 / 5e-53 ferredoxin 3 (.1)
Lus10001369 134 / 7e-41 AT1G60950 186 / 1e-61 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10015462 132 / 5e-40 AT1G60950 182 / 8e-60 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10006116 83 / 9e-21 AT4G14890 186 / 1e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10010557 84 / 4e-20 AT4G14890 188 / 5e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10000483 77 / 5e-18 AT1G32550 245 / 7e-84 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Lus10004576 76 / 2e-17 AT1G32550 248 / 6e-85 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G239100 201 / 6e-67 AT2G27510 175 / 7e-57 ferredoxin 3 (.1)
Potri.008G020100 200 / 9e-67 AT2G27510 180 / 5e-59 ferredoxin 3 (.1)
Potri.009G163800 179 / 2e-58 AT2G27510 167 / 7e-54 ferredoxin 3 (.1)
Potri.004G202500 179 / 5e-58 AT2G27510 164 / 3e-52 ferredoxin 3 (.1)
Potri.003G015200 141 / 1e-43 AT1G60950 176 / 2e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.004G218400 136 / 9e-42 AT1G60950 194 / 9e-65 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.001G470700 132 / 6e-40 AT1G60950 174 / 7e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.010G087300 82 / 2e-20 AT4G14890 189 / 7e-63 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.008G153200 82 / 3e-20 AT4G14890 193 / 2e-64 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.003G090400 76 / 2e-17 AT1G32550 257 / 3e-88 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0486 Fer2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Representative CDS sequence
>Lus10043430 pacid=23168295 polypeptide=Lus10043430 locus=Lus10043430.g ID=Lus10043430.BGIv1.0 annot-version=v1.0
ATGTCGACAGTAAAGCTTCCACTCTCCTGCATGATCCAAGCTGCACCTGTTTCCAAAGGTACGGTACAAAGCAGACCCCAGCTGGCATTGGCAAACGCCC
CGAATTCGTTTGGTTCTTCTTCGAAGAAAAACATATCAGGGGGAATAGTTGGTTTCAAGTCGAGATCATCATCGTTGAGCGTAGCTTGTGCAACGACAGT
ATACAAGGTGAAACTGGTTGGACCAGATGGGGAGGAGCACGAGTTCGAAGCTCCCGACGATACGTATATCCTGGATGCAGCTGAAAATGCAGGAGTGGAC
CTTCCCTACTCGTGCAGGGCTGGTGCTTGCTCTACTTGCGCAGGACAGTTGGTGTCAGGGTCAGTGGACCAATCAGACGGCTCGTTCCTTGACGATAAGC
AGATTAAGAAAGGGTATGTCCTCACCTGCATCGCGTATCCCACAGCCGATTGTGTGATCCATACCCATAAGGAGTCTGATCTTTACTAA
AA sequence
>Lus10043430 pacid=23168295 polypeptide=Lus10043430 locus=Lus10043430.g ID=Lus10043430.BGIv1.0 annot-version=v1.0
MSTVKLPLSCMIQAAPVSKGTVQSRPQLALANAPNSFGSSSKKNISGGIVGFKSRSSSLSVACATTVYKVKLVGPDGEEHEFEAPDDTYILDAAENAGVD
LPYSCRAGACSTCAGQLVSGSVDQSDGSFLDDKQIKKGYVLTCIAYPTADCVIHTHKESDLY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27510 ATFD3 ferredoxin 3 (.1) Lus10043430 0 1
AT1G72280 AERO1 endoplasmic reticulum oxidored... Lus10023292 7.9 0.7916
AT1G03070 Bax inhibitor-1 family protein... Lus10042631 9.1 0.7892
AT1G08830 CSD1 copper/zinc superoxide dismuta... Lus10001719 24.5 0.7552
AT2G44200 CBF1-interacting co-repressor ... Lus10039128 26.5 0.7341
Lus10031757 27.5 0.7356
AT1G16180 Serinc-domain containing serin... Lus10008709 30.9 0.7658
AT4G16210 ECHIA, E-COAH-2 ENOYL-COA HYDRATASE 2, enoyl-C... Lus10037777 31.5 0.7607
AT1G12060 ATBAG5 BCL-2-associated athanogene 5 ... Lus10010486 31.6 0.7430
AT5G58375 Methyltransferase-related prot... Lus10042227 33.0 0.7529
AT2G02970 GDA1/CD39 nucleoside phosphata... Lus10030470 42.8 0.7258

Lus10043430 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.