Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03610 81 / 2e-19 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G09930 76 / 6e-18 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT5G03590 59 / 5e-12 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT5G03600 55 / 3e-10 SGNH hydrolase-type esterase superfamily protein (.1) AT2G36325 47 / 2e-07 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035600 [exp] 83 / 3e-20 AT5G03610 397 / 7e-138 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10003253 [exp] 83 / 3e-20 AT5G03610 397 / 2e-138 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10028145 [exp] 66 / 6e-14 AT5G03610 234 / 2e-74 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10042849 [exp] 54 / 6e-10 AT5G03610 240 / 1e-72 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G237000 [exp] 107 / 1e-29 AT5G03610 352 / 1e-120 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.001G406500 [exp] 81 / 2e-19 AT5G03610 425 / 3e-149 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.005G053100 [exp] 69 / 4e-15 AT5G03610 205 / 3e-63 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.010G236800 [exp] 49 / 5e-08 AT5G03610 255 / 5e-83 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.010G236951 [exp] 46 / 5e-07 AT5G03610 244 / 2e-78 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.010G230100 [exp] 45 / 8e-07 AT5G03610 164 / 2e-48 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043442 pacid=23167922 polypeptide=Lus10043442 locus=Lus10043442.g ID=Lus10043442.BGIv1.0 annot-version=v1.0 ATGAATACATATACCTTGATGATTCCAGGGAAACATGAGCCTGACCGCAATCTGCTTAAGCCGTGCTGTACTGGAGTGACGAGTGGTTACAACTGCGGAG ATGTAGACCGGAGCACCGGAGCAAAGAAATATGTGGTATGCGACAAACCGAATCTATCCTTGTTCTGGGATATGGTTCATCCTGCTCAAAATGGCTGGCA TGCAGTTTATCAGACTCTGGAATCTTCCCTTCATCAGCTTCAGTTTAATGAGTTCAAGCTAAACATATAG
AA sequence Show only first row Show all	>Lus10043442 pacid=23167922 polypeptide=Lus10043442 locus=Lus10043442.g ID=Lus10043442.BGIv1.0 annot-version=v1.0 MNTYTLMIPGKHEPDRNLLKPCCTGVTSGYNCGDVDRSTGAKKYVVCDKPNLSLFWDMVHPAQNGWHAVYQTLESSLHQLQFNEFKLNI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10043442 [exp]	0	1
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10043441 [exp]	1.0	0.9579
AT3G53730			Histone superfamily protein (....		Lus10004949 [exp]	4.2	0.8932
AT5G43140			Peroxisomal membrane 22 kDa (M...		Lus10007761 [exp]	5.9	0.8390
					Lus10035688 [exp]	7.7	0.8640
					Lus10018463 [exp]	12.3	0.8625
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10014043 [exp]	12.5	0.8432
AT1G29395		COR413IM1, COR4...	cold regulated 414 thylakoid m...		Lus10004547 [exp]	15.4	0.7782
AT1G44760			Adenine nucleotide alpha hydro...		Lus10029664 [exp]	16.1	0.8286
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10019871 [exp]	17.0	0.8330
AT3G20260			Protein of unknown function (D...		Lus10034809 [exp]	17.2	0.8594

Compare expression of checked genes

Lus10043442 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.