Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56240 120 / 2e-36 ATX1, CCH copper chaperone (.1) AT1G66240 118 / 1e-35 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.2.3) AT5G27690 67 / 5e-14 Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 64 / 9e-14 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT2G37390 65 / 1e-13 NAKR2 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) AT5G02600 65 / 3e-13 NPCC6, NAKR1 nuclear-enriched phloem companion cell gene 6, SODIUM POTASSIUM ROOT DEFECTIVE 1, Heavy metal transport/detoxification superfamily protein (.1.2) AT1G06330 62 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 62 / 6e-13 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT4G08570 61 / 1e-12 Heavy metal transport/detoxification superfamily protein (.1) AT3G56891 60 / 4e-12 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028859 [exp] 118 / 7e-35 AT1G66240 125 / 8e-38 homolog of anti-oxidant 1 (.1.2.3) Lus10034138 [exp] 119 / 2e-34 AT1G66240 115 / 1e-32 homolog of anti-oxidant 1 (.1.2.3) Lus10008963 [exp] 79 / 4e-19 AT1G66240 81 / 5e-20 homolog of anti-oxidant 1 (.1.2.3) Lus10024435 [exp] 71 / 1e-15 AT2G37390 144 / 2e-41 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10025294 [exp] 71 / 3e-15 AT2G37390 141 / 3e-40 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10019676 [exp] 64 / 8e-14 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 64 / 8e-14 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 64 / 1e-13 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10016812 [exp] 64 / 1e-13 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G023800 [exp] 119 / 2e-36 AT1G66240 124 / 7e-39 homolog of anti-oxidant 1 (.1.2.3) Potri.010G236500 [exp] 118 / 7e-36 AT1G66240 129 / 1e-40 homolog of anti-oxidant 1 (.1.2.3) Potri.002G092200 [exp] 70 / 3e-16 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G024800 [exp] 70 / 5e-16 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 69 / 1e-15 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 68 / 2e-15 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 66 / 2e-14 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1) Potri.016G080400 [exp] 67 / 5e-14 AT2G37390 133 / 2e-37 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.006G213900 [exp] 66 / 9e-14 AT2G37390 127 / 2e-35 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.001G234700 [exp] 64 / 6e-13 AT2G37390 114 / 2e-30 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10043444 pacid=23168348 polypeptide=Lus10043444 locus=Lus10043444.g ID=Lus10043444.BGIv1.0 annot-version=v1.0 ATGACTCAGACTGTTGTCCTCAAGGTTGCAATGTCCTGCGGGGGATGCTCCGGGGCTGTCAATAGGGTCTTGTCCAAAATGGAAGGTGTGGAGTCTTTCG ACATTGACATGAAGGAGCAGAAAGTTACAGTGAAGGGAAACGTGGAGCCAGATGCTGTCTTCCAGACCGTGTCGAAGACCGGGAAGAAGACTGCATTCTG GGAAGCAGAAGAACCTGCAGCAGCACCAGAAACAAAGCCTGCTGAGTCGGAGACTGCGGCTGCAGCAGCTGCACCGGAGACAAAGCCCGCTGAGCCAGAG ACCGTTGCTGCTGCAGCTGCACCTGTACCAGAAACAAAACCCGCTGAGCCAGAGACCGTCACCACTGCATAG
AA sequence Show only first row Show all	>Lus10043444 pacid=23168348 polypeptide=Lus10043444 locus=Lus10043444.g ID=Lus10043444.BGIv1.0 annot-version=v1.0 MTQTVVLKVAMSCGGCSGAVNRVLSKMEGVESFDIDMKEQKVTVKGNVEPDAVFQTVSKTGKKTAFWEAEEPAAAPETKPAESETAAAAAAPETKPAEPE TVAAAAAPVPETKPAEPETVTTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G66240		ATX1, ATATX1	homolog of anti-oxidant 1 (.1....		Lus10043444 [exp]	0	1
AT5G47635			Pollen Ole e 1 allergen and ex...		Lus10039078 [exp]	5.7	0.8987
AT5G20650		COPT5	copper transporter 5 (.1)		Lus10009819 [exp]	6.5	0.8686
AT3G09770		LOG2	LOSS OF GDU 2, RING/U-box supe...		Lus10015080 [exp]	7.4	0.8759
AT5G47635			Pollen Ole e 1 allergen and ex...		Lus10038781 [exp]	8.7	0.9081
AT5G20650		COPT5	copper transporter 5 (.1)		Lus10040925 [exp]	11.8	0.8624
AT5G02090			unknown protein		Lus10010878 [exp]	20.3	0.8908
AT4G38580		HIPP26, ATFP6	HEAVY METAL ASSOCIATED ISOPREN...		Lus10028426 [exp]	22.1	0.8667
AT3G15480			Protein of unknown function (D...		Lus10043091 [exp]	24.5	0.8773
AT5G47810		PFK2	phosphofructokinase 2 (.1)		Lus10008812 [exp]	29.0	0.8489
AT5G08100		ASPGA1	asparaginase A1, N-terminal nu...		Lus10034655 [exp]	29.2	0.7939

Compare expression of checked genes

Lus10043444 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.