Lus10043467 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10043467 pacid=23168051 polypeptide=Lus10043467 locus=Lus10043467.g ID=Lus10043467.BGIv1.0 annot-version=v1.0
ATGGAAAGGAGATTTGGATATCAAGGATATTACGGTAGAATTTGCTCACAACCTCTCACTCCTATTTTCTCTCTTTTGGAACCAAAAAAACCCAACGTGG
AAGCCTCGTTGAATCGACGCTGTCAGGAGCAGTCCAATTTAGTCTCCCTCATTGACTACCGTCTCAAGTCGCGCCTTCTTTCACAGGAACAGGGGAATCA
GAGCCGTCAGGTACCGGGTGTTCGAATTGGAAAAGTCAAGAACCAAATGTTAGAAACAGTTAAGTCACTGGCGACATTGTTTTATTTCTTTGGGATTGGT
TTCAGCACTAACTACCAGTTCTTCTACATCAGCAACCGCTTTCGATAA
AA sequence
>Lus10043467 pacid=23168051 polypeptide=Lus10043467 locus=Lus10043467.g ID=Lus10043467.BGIv1.0 annot-version=v1.0
MERRFGYQGYYGRICSQPLTPIFSLLEPKKPNVEASLNRRCQEQSNLVSLIDYRLKSRLLSQEQGNQSRQVPGVRIGKVKNQMLETVKSLATLFYFFGIG
FSTNYQFFYISNRFR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10043467 0 1
AT5G51780 bHLH bHLH036 basic helix-loop-helix (bHLH) ... Lus10027394 5.8 0.8529
AT5G51780 bHLH bHLH036 basic helix-loop-helix (bHLH) ... Lus10031677 11.6 0.8401
AT5G51780 bHLH bHLH036 basic helix-loop-helix (bHLH) ... Lus10031676 12.2 0.8429
AT2G42900 Plant basic secretory protein ... Lus10031462 17.6 0.8098
AT2G17080 Arabidopsis protein of unknown... Lus10025121 17.9 0.8198
AT3G52200 LTA3 Dihydrolipoamide acetyltransfe... Lus10008412 18.4 0.7650
AT3G13235 DDI1 DNA-damage inducible 1, ubiqui... Lus10020464 18.5 0.8208
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Lus10022883 18.9 0.8300
AT3G26040 HXXXD-type acyl-transferase fa... Lus10001107 19.4 0.8126
AT1G64960 HEB1 hypersensitive to excess boron... Lus10025198 19.9 0.8212

Lus10043467 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.