Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19020 56 / 8e-12 unknown protein AT3G48180 54 / 3e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034115 [exp] 117 / 2e-32 AT3G48170 825 / 0.0 aldehyde dehydrogenase 10A9 (.1) Lus10030823 [exp] 61 / 1e-13 AT3G48180 72 / 2e-18 unknown protein Lus10027187 [exp] 37 / 0.0001 AT3G48180 43 / 5e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G070700 [exp] 70 / 3e-17 AT1G19020 83 / 1e-22 unknown protein Potri.012G075800 [exp] 69 / 7e-17 AT1G19020 82 / 3e-22 unknown protein Potri.014G153900 [exp] 39 / 2e-05 AT1G19020 40 / 1e-05 unknown protein Potri.011G004400 [exp] 37 / 0.0002 AT1G62045 47 / 2e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10043469 pacid=23168162 polypeptide=Lus10043469 locus=Lus10043469.g ID=Lus10043469.BGIv1.0 annot-version=v1.0 ATGGCAGCAGCAAACGGCGGGTCGTACGGAACATCGTGGGCGGACCAGTGGGATTCCGGGCCTGACCCTGTTTACCAACCCGCCCCCAAGGGCAACGGCG GCGGCGGCGACGGGGGAAAGTACAAGCAGAAGGTGGGAGATGGTTTGGGGAAAACGAAGTCGGCGGCGGTGACCGGAATGAAGAAGGTCAAACAAGGGAC TTCGGTCGGGTTCCAGTGGCTCAAAGACAAGTACCACAAGTCTACAAACAAATCATAA
AA sequence Show only first row Show all	>Lus10043469 pacid=23168162 polypeptide=Lus10043469 locus=Lus10043469.g ID=Lus10043469.BGIv1.0 annot-version=v1.0 MAAANGGSYGTSWADQWDSGPDPVYQPAPKGNGGGGDGGKYKQKVGDGLGKTKSAAVTGMKKVKQGTSVGFQWLKDKYHKSTNKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48180			unknown protein		Lus10043469 [exp]	0	1
AT4G04450	WRKY	ATWRKY42, WRKY4...	WRKY family transcription fact...		Lus10020023 [exp]	2.6	0.9924
AT5G01250			alpha 1,4-glycosyltransferase ...		Lus10027770 [exp]	3.5	0.9854
AT1G30370		DLAH	DAD1-like acylhydrolase, alpha...		Lus10023280 [exp]	4.0	0.9886
					Lus10041163 [exp]	4.5	0.9911
AT3G09220		LAC7	laccase 7 (.1)		Lus10027747 [exp]	5.7	0.9848
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10027586 [exp]	6.0	0.9825
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10021314 [exp]	6.9	0.9898
AT2G35980		NHL10, YLS9, AT...	YELLOW-LEAF-SPECIFIC GENE 9, A...		Lus10016962 [exp]	7.1	0.9880
AT1G14590			Nucleotide-diphospho-sugar tra...		Lus10017981 [exp]	7.5	0.9867
					Lus10027919 [exp]	8.3	0.9809

Compare expression of checked genes

Lus10043469 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.