Lus10043475 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G113300 43 / 1e-05 AT1G23040 42 / 2e-05 hydroxyproline-rich glycoprotein family protein (.1)
Potri.008G129100 38 / 0.0009 AT1G23040 41 / 5e-05 hydroxyproline-rich glycoprotein family protein (.1)
PFAM info
Representative CDS sequence
>Lus10043475 pacid=23168127 polypeptide=Lus10043475 locus=Lus10043475.g ID=Lus10043475.BGIv1.0 annot-version=v1.0
ATGACAGACACCGCCGCCGCCGATTCAAGAAAGCTAGACGAAACTACCTCCGACATCCCCGGCTCCGAGAAGTGCACTCCCTGTGACCCCACACCTCCGC
CGCCGCCTCCGCCAGCCTGTCCACCTCCACCTCCTCCAGCTCTGCCTCCCCCGTCTCCGCCTCCGCCAAAGAACCCCCCTTCCGCCAACTGCCCACCGCC
CCCTTCTCCTCCATCGCCTTCCTCGATCATTTACATAACCGGCCCACCGGGAAACCTGTACCCGGTCGACGACGACATGAGCGGATCCCGCCGGATTTCC
GTTCAGACGGCGGCGGGGGGGGGGGTGGGGGGGCGGTGGGGGGGCGATATGAGTGTGCACGATTCGGAATCTGATGAAGGAATTTGTTGTGTTGTTCTTT
CTCCCCAAATTGGAGAGTTATATTAG
AA sequence
>Lus10043475 pacid=23168127 polypeptide=Lus10043475 locus=Lus10043475.g ID=Lus10043475.BGIv1.0 annot-version=v1.0
MTDTAAADSRKLDETTSDIPGSEKCTPCDPTPPPPPPPACPPPPPPALPPPSPPPPKNPPSANCPPPPSPPSPSSIIYITGPPGNLYPVDDDMSGSRRIS
VQTAAGGGVGGRWGGDMSVHDSESDEGICCVVLSPQIGELY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G23040 hydroxyproline-rich glycoprote... Lus10043475 0 1
AT3G10080 RmlC-like cupins superfamily p... Lus10014192 1.7 0.9135
AT5G45420 MYB maMYB membrane anchored MYB, Duplica... Lus10039841 2.6 0.9331
AT1G19910 AVA-2PE, ATVHA-... VACUOLAR-TYPE H+ ATPASE C2, AT... Lus10010619 2.6 0.9012
AT1G19910 AVA-2PE, ATVHA-... VACUOLAR-TYPE H+ ATPASE C2, AT... Lus10028367 2.8 0.8992
AT5G18520 Lung seven transmembrane recep... Lus10009065 5.5 0.9182
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10042295 8.7 0.8362
AT3G16050 A37, ATPDX1.2 ARABIDOPSIS THALIANA PYRIDOXIN... Lus10011450 9.2 0.9012
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10017425 9.7 0.9020
AT3G45230 hydroxyproline-rich glycoprote... Lus10041306 11.5 0.9040
AT3G45230 hydroxyproline-rich glycoprote... Lus10037404 12.6 0.8937

Lus10043475 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.