Lus10043476 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23050 42 / 4e-05 hydroxyproline-rich glycoprotein family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034112 86 / 6e-22 AT1G70985 58 / 3e-11 hydroxyproline-rich glycoprotein family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10043476 pacid=23168075 polypeptide=Lus10043476 locus=Lus10043476.g ID=Lus10043476.BGIv1.0 annot-version=v1.0
ATGCCCACCGCTTCCTTAATCGCCGCTGCCGCCACGTCACTTCTCCTCCTCTGCCTACTACCTGCCTTCACCATAGCCGACGACACATGCCCTTACCCAT
GTTACCCTCCTCCAACCGCCCCCGGATCCCCTGCCTCCGTCACCAGCAACCCACCTCCGTCTTCTCAATCCTCATCGTATCCTCCGCCTCCGGCCGGCTA
CTACCCTTCGCCGGCGGGTAATTACTATATCCCGCCGCCGCCTTCAGGAAACAATAACAACTATGGCTACAACAATCCACCACCCAACGCTATCCTTCCC
TACTTCCCTTACTACTACAGAAAGCCTCCCCAAAATCCTGACGGTTCTGGGTCAACGCCGCCGCTGCTGGTCGGAGTCTGGTGGGCGACGACGGTGGTGG
CGTCCGGGGTTATCTTGTTGGGGCTTTTCTAG
AA sequence
>Lus10043476 pacid=23168075 polypeptide=Lus10043476 locus=Lus10043476.g ID=Lus10043476.BGIv1.0 annot-version=v1.0
MPTASLIAAAATSLLLLCLLPAFTIADDTCPYPCYPPPTAPGSPASVTSNPPPSSQSSSYPPPPAGYYPSPAGNYYIPPPPSGNNNNYGYNNPPPNAILP
YFPYYYRKPPQNPDGSGSTPPLLVGVWWATTVVASGVILLGLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G23050 hydroxyproline-rich glycoprote... Lus10043476 0 1
AT1G07710 Ankyrin repeat family protein ... Lus10003748 6.7 0.8003
AT4G18400 unknown protein Lus10023291 7.1 0.7222
AT5G10530 Concanavalin A-like lectin pro... Lus10029554 11.4 0.7677
AT1G16180 Serinc-domain containing serin... Lus10008709 16.7 0.7913
AT1G55190 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, ... Lus10005088 18.1 0.7701
AT1G49420 Heavy metal transport/detoxifi... Lus10038786 22.0 0.7426
AT5G58375 Methyltransferase-related prot... Lus10042227 28.4 0.7643
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10038866 29.1 0.7365
AT5G21090 Leucine-rich repeat (LRR) fami... Lus10026751 31.6 0.7526
AT2G20230 Tetraspanin family protein (.1... Lus10022841 31.9 0.7434

Lus10043476 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.