Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09830 99 / 1e-26 Uncharacterised conserved protein UCP009193 (.1) AT5G64780 89 / 3e-23 Uncharacterised conserved protein UCP009193 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G064800 [exp] 95 / 4e-25 AT4G09830 231 / 1e-77 Uncharacterised conserved protein UCP009193 (.1) Potri.005G196400 [exp] 91 / 1e-23 AT4G09830 220 / 2e-73 Uncharacterised conserved protein UCP009193 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028732 [exp] 89 / 1e-22 AT4G09830 203 / 6e-67 Uncharacterised conserved protein UCP009193 (.1) Lus10028692 [exp] 88 / 2e-22 AT4G09830 207 / 3e-68 Uncharacterised conserved protein UCP009193 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G003400.1 pacid=42790805 polypeptide=Potri.001G003400.1.p locus=Potri.001G003400 ID=Potri.001G003400.1.v4.1 annot-version=v4.1 ATGGCGAGGAAGAGGAAAGTGGAAAGTAGCGCAGCGATAGTAGATGAGAGTGACAAAGTTTTGTATTCAGCGTTTAGAAATTCTGCTAATGAACTCTCTC AATTATACTCTCAAGCAATCAGTCATAACAAGCTTTCTTTTGAAGCTGGACAAAGACATGCTCTCGAGAAACTGAGTAACTGGATGGCAGTGAAGCAGCA AGGTGGAATAATGGTGACAACAGAAGACATTTCTACTTATCTGCAGAGTGAGCTGAACAATATTTCCAACGCTAGTTATGACTCACATGGTGGCCGGAAT GAGGTGAACTCATCTATCACAACTCCTGTCATACAAAGCCAAGATAAAAACCTATGTTTGTCTTTCGATTCAGAAATGGATACAACTCCTGAAGGATCTG CTCACTAA
AA sequence Show only first row Show all	>Potri.001G003400.1 pacid=42790805 polypeptide=Potri.001G003400.1.p locus=Potri.001G003400 ID=Potri.001G003400.1.v4.1 annot-version=v4.1 MARKRKVESSAAIVDESDKVLYSAFRNSANELSQLYSQAISHNKLSFEAGQRHALEKLSNWMAVKQQGGIMVTTEDISTYLQSELNNISNASYDSHGGRN EVNSSITTPVIQSQDKNLCLSFDSEMDTTPEGSAH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G09830			Uncharacterised conserved prot...		Potri.001G003400 [exp]	0	1
AT5G53280		PDV1	plastid division1 (.1)		Potri.015G022900 [exp]	2.82	0.8712
AT1G65560			Zinc-binding dehydrogenase fam...		Potri.010G177700 [exp]	3.46	0.8622
AT5G17570			TatD related DNase (.1)		Potri.013G073800 [exp]	4.24	0.8289
AT5G20060			alpha/beta-Hydrolases superfam...		Potri.018G070700 [exp]	6.70	0.8634
AT3G20800			Cell differentiation, Rcd1-lik...		Potri.001G359300 [exp]	7.00	0.7849
AT1G17100			SOUL heme-binding family prote...		Potri.001G067100 [exp]	7.34	0.8388
AT3G23490		CYN	cyanase (.1)		Potri.010G068200 [exp]	8.00	0.8007	Pt-CYN.1
AT2G17695			unknown protein		Potri.005G105500 [exp]	11.22	0.8342
AT1G01050		ATPPA1	pyrophosphorylase 1 (.1)		Potri.007G022700 [exp]	11.31	0.8178
AT1G77090			Mog1/PsbP/DUF1795-like photosy...		Potri.002G072400 [exp]	12.56	0.8681

Compare expression of checked genes

Potri.001G003400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.