Plant FIBer expression Database

Pt-AGP13.2 (Potri.001G004100) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-AGP13.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G56540 45 / 2e-08 ATAGP14, AGP14 arabinogalactan protein 14 (.1)
AT4G26320 41 / 8e-07 AGP13 arabinogalactan protein 13 (.1)
AT3G13520 40 / 3e-06 ATAGP12, AGP12 arabinogalactan protein 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G220900
[exp]
68 / 2e-16 AT5G56540 43 / 2e-06 arabinogalactan protein 14 (.1)
Potri.013G057500
[exp]
48 / 2e-09 AT5G56540 / arabinogalactan protein 14 (.1)
Potri.019G035500
[exp]
47 / 3e-09 AT5G56540 / arabinogalactan protein 14 (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G004100.1 pacid=42787583 polypeptide=Potri.001G004100.1.p locus=Potri.001G004100 ID=Potri.001G004100.1.v4.1 annot-version=v4.1
ATGGAGGCAATGAAAATGAAGATCTTTGTTGTGTTGATGGTGGTCTTGATGGCCTTCTCAACCATGCAAAAGGCTGCAGCTGCCGATGCACCAGCACCAA
GCCCAACATCTGATGCCACTATCTTTGTTCCCACGTTCTTGGCATCTCTTGTTGCTCTTGCTTTCGGGTTGCTCTTTTGA
AA sequence
>Potri.001G004100.1 pacid=42787583 polypeptide=Potri.001G004100.1.p locus=Potri.001G004100 ID=Potri.001G004100.1.v4.1 annot-version=v4.1
MEAMKMKIFVVLMVVLMAFSTMQKAAAADAPAPSPTSDATIFVPTFLASLVALAFGLLF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G56540 ATAGP14, AGP14 arabinogalactan protein 14 (.1... Potri.001G004100
[exp]
0 1 Pt-AGP13.2
AT1G54790 GDSL-like Lipase/Acylhydrolase... Potri.005G038800
[exp]
1.73 0.9104
AT4G00430 PIP1;4, TMP-C, ... TRANSMEMBRANE PROTEIN C, PLASM... Potri.003G128600
[exp]
2.82 0.8863
AT3G62020 GLP10 germin-like protein 10 (.1.2) Potri.014G110400
[exp]
3.46 0.8700 GLP10.2
AT2G41560 ACA4 "autoinhibited Ca\(2+\)-ATPase... Potri.001G020600
[exp]
3.74 0.8737
Potri.019G129700
[exp]
6.48 0.8861
AT2G04850 Auxin-responsive family protei... Potri.002G222600
[exp]
9.48 0.8849
AT1G63260 TET10 tetraspanin10 (.1.2.3) Potri.001G107200
[exp]
10.58 0.8716
AT5G15740 RRT1 O-fucosyltransferase family pr... Potri.015G048100
[exp]
12.12 0.8564
Potri.006G072300
[exp]
12.32 0.8168
AT3G18660 PGSIP1, GUX1 glucuronic acid substitution o... Potri.007G107200
[exp]
12.48 0.8851

Potri.001G004100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.