Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11950 269 / 2e-92 LOG8 LONELY GUY 8, Putative lysine decarboxylase family protein (.1.2) AT2G28305 260 / 6e-89 ATLOG1 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) AT2G35990 254 / 9e-87 LOG2 LONELY GUY 2, Putative lysine decarboxylase family protein (.1.2.3) AT2G37210 254 / 1e-86 LOG3 LONELY GUY 3, lysine decarboxylase family protein (.1.2) AT3G53450 253 / 4e-86 LOG4 LONELY GUY 4, Putative lysine decarboxylase family protein (.1) AT5G06300 245 / 8e-83 LOG7 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) AT4G35190 235 / 1e-78 LOG5 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) AT5G03270 192 / 6e-62 LOG6 LONELY GUY 6, lysine decarboxylase family protein (.1) AT5G26140 167 / 4e-53 ATLOG9 LONELY GUY 9, Putative lysine decarboxylase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G219300 [exp] 337 / 3e-119 AT5G11950 300 / 1e-104 LONELY GUY 8, Putative lysine decarboxylase family protein (.1.2) Potri.006G226100 [exp] 271 / 3e-93 AT5G11950 362 / 6e-129 LONELY GUY 8, Putative lysine decarboxylase family protein (.1.2) Potri.001G265300 [exp] 271 / 3e-93 AT2G28305 288 / 9e-100 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.009G060300 [exp] 270 / 6e-93 AT2G28305 315 / 3e-110 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.016G090500 [exp] 264 / 4e-90 AT2G37210 392 / 8e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.009G010800 [exp] 262 / 9e-90 AT2G28305 359 / 8e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.004G212200 [exp] 261 / 3e-89 AT2G28305 361 / 1e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.006G127400 [exp] 261 / 5e-89 AT2G37210 396 / 3e-142 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.006G204800 [exp] 254 / 2e-86 AT5G06300 316 / 9e-111 LONELY GUY 7, Putative lysine decarboxylase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026131 [exp] 271 / 4e-93 AT5G11950 350 / 4e-124 LONELY GUY 8, Putative lysine decarboxylase family protein (.1.2) Lus10016096 [exp] 261 / 5e-89 AT2G28305 384 / 7e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10026513 [exp] 260 / 1e-88 AT2G37210 394 / 1e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10021462 [exp] 259 / 3e-88 AT2G28305 386 / 1e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10002226 [exp] 245 / 6e-83 AT2G37210 379 / 2e-135 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10012436 [exp] 245 / 9e-83 AT5G06300 332 / 7e-117 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10024328 [exp] 243 / 4e-82 AT5G06300 328 / 2e-115 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10025117 [exp] 241 / 9e-81 AT4G35190 373 / 1e-132 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10022638 [exp] 237 / 2e-79 AT4G35190 365 / 2e-129 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10003335 [exp] 236 / 4e-79 AT4G35190 359 / 2e-127 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0349 [poplar] [flax] SLOG PF03641 [poplar] [flax] Lysine_decarbox Possible lysine decarboxylase
Representative CDS sequence Show only first row Show all	>Potri.001G005400.1 pacid=42793280 polypeptide=Potri.001G005400.1.p locus=Potri.001G005400 ID=Potri.001G005400.1.v4.1 annot-version=v4.1 ATGGGAAAGTTCACAAGGGTTTGTGTCTTTTGTGGAAGTAAGTCAGGGAATAAAAAGATATTCAGTGATGCAGCCCTTGATCTTGGAAGACAACTGGTTG AGAGGAAGATGGATTTAGTGTATGGAGGAGGGAGTGTTGGATTGATGGGGCTTGTTTCTCAAACAGTTTATGATGGCGGGAGTCATGTTTTAGGAATTAT ACCAACAGCTCTTGTACCAATTGAGATTTCAGGTGAAACTGTTGGAGAAGTATTAATTGTATCCGATATGCATGAAAGGAAGGCAGAGATGGCTCGGAGA GCTGATGCTTTCATTGCTCTTCCTGGAGGGTATGGAACCTTCGAGGAGTTGCTTGAGATGATAACTTGGTCTCAGCTTGGAATCCATAACAAGCCAGTGG GACTGTTAAATGTTGATGGGTACTATGATAGCTTGCTTGGATTATTTGACAAAAGTGTAGAAGAAGGATTTGTTAATGCTTCTGCAAGGAACATTGTCGT GTCTGCAAGGACTGCTAGAGAGCTAATCCAGAGAATGGAGGATTATATACCTGTCCATGAACAAGTGACATCAAATCAAAGCTGCAATGTAGAAGAGTGC AATGCAAATTTTTAG
AA sequence Show only first row Show all	>Potri.001G005400.1 pacid=42793280 polypeptide=Potri.001G005400.1.p locus=Potri.001G005400 ID=Potri.001G005400.1.v4.1 annot-version=v4.1 MGKFTRVCVFCGSKSGNKKIFSDAALDLGRQLVERKMDLVYGGGSVGLMGLVSQTVYDGGSHVLGIIPTALVPIEISGETVGEVLIVSDMHERKAEMARR ADAFIALPGGYGTFEELLEMITWSQLGIHNKPVGLLNVDGYYDSLLGLFDKSVEEGFVNASARNIVVSARTARELIQRMEDYIPVHEQVTSNQSCNVEEC NANF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G11950		LOG8	LONELY GUY 8, Putative lysine ...		Potri.001G005400 [exp]	0	1
AT1G66180			Eukaryotic aspartyl protease f...		Potri.004G085000 [exp]	1.41	0.8152
AT2G29130		LAC2, ATLAC2	laccase 2 (.1)		Potri.009G034500 [exp]	6.00	0.7417
AT1G14190			Glucose-methanol-choline (GMC)...		Potri.010G168200 [exp]	6.00	0.7965
AT3G61180			RING/U-box superfamily protein...		Potri.014G075000 [exp]	8.48	0.7299
AT5G26594		ARR24	response regulator 24 (.1)		Potri.002G253000 [exp]	10.09	0.7649
AT1G67856			RING/U-box superfamily protein...		Potri.008G185800 [exp]	15.16	0.7362
AT3G15760			unknown protein		Potri.018G131100 [exp]	16.73	0.6723
AT1G18470			Transmembrane Fragile-X-F-asso...		Potri.015G050300 [exp]	19.97	0.6662
AT4G37530			Peroxidase superfamily protein...		Potri.001G329200 [exp]	22.13	0.7141
AT1G26320			Zinc-binding dehydrogenase fam...		Potri.017G003950 [exp]	23.32	0.7181

Compare expression of checked genes

Potri.001G005400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.