Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13610 129 / 7e-38 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G55290 127 / 5e-37 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G12900 89 / 8e-23 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G12270 83 / 2e-20 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16330 60 / 2e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G78550 57 / 2e-11 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 56 / 6e-11 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 56 / 7e-11 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G30040 55 / 2e-10 ATGA2OX2 GIBBERELLIN 2-OXIDASE 2, gibberellin 2-oxidase (.1.2) AT3G21420 54 / 5e-10 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G006901 [exp] 162 / 9e-51 AT3G13610 520 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G007100 [exp] 140 / 2e-42 AT1G55290 496 / 4e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G097900 [exp] 87 / 6e-22 AT3G12900 471 / 4e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G107500 [exp] 83 / 2e-20 AT1G03400 302 / 3e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G024100 [exp] 66 / 4e-14 AT4G16330 419 / 7e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G023600 [exp] 61 / 2e-12 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150100 [exp] 59 / 5e-12 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G121800 [exp] 59 / 6e-12 AT5G54000 407 / 2e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.015G002800 [exp] 58 / 2e-11 AT5G24530 521 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036082 [exp] 106 / 3e-29 AT1G55290 395 / 2e-137 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10037292 [exp] 69 / 2e-15 AT4G16330 416 / 5e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10007818 [exp] 67 / 1e-14 AT1G03400 315 / 9e-106 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10035702 [exp] 64 / 1e-13 AT4G16330 347 / 4e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011980 [exp] 62 / 7e-13 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1) Lus10011981 [exp] 62 / 9e-13 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1) Lus10006518 [exp] 58 / 2e-11 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015252 [exp] 58 / 2e-11 AT1G17020 375 / 1e-129 senescence-related gene 1 (.1) Lus10038498 [exp] 56 / 3e-11 AT1G78440 258 / 2e-86 Arabidopsis thaliana gibberellin 2-oxidase 1 (.1) Lus10011986 [exp] 57 / 4e-11 AT1G17020 291 / 3e-96 senescence-related gene 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G006750.1 pacid=42792375 polypeptide=Potri.001G006750.1.p locus=Potri.001G006750 ID=Potri.001G006750.1.v4.1 annot-version=v4.1 ATGAGCAATGGTCGATACAAGAGCATCGAGCACCGTGTTATTGCTAACGGAAGTAATAACAGGATTTCAGTTCCCATTTTCATCAACCCCATGCCATCAG ACAAAATCTCTCCTTTCCCTGAAGTGCTGGCCAGTGGCGAGAAGGCCGTGTATAAGGAAGTTCTGTACTCGGATTACGTCAAGCATTTCTTCCGAAAAGC ACATGATGGGAAGAAAACAATCGATTTGGCAAAGATATAA
AA sequence Show only first row Show all	>Potri.001G006750.1 pacid=42792375 polypeptide=Potri.001G006750.1.p locus=Potri.001G006750 ID=Potri.001G006750.1.v4.1 annot-version=v4.1 MSNGRYKSIEHRVIANGSNNRISVPIFINPMPSDKISPFPEVLASGEKAVYKEVLYSDYVKHFFRKAHDGKKTIDLAKI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G13610			2-oxoglutarate (2OG) and Fe(II...		Potri.001G006750 [exp]	0	1
AT3G13610			2-oxoglutarate (2OG) and Fe(II...		Potri.001G006901 [exp]	2.44	0.9951
AT3G10480	NAC	ANAC050	NAC domain containing protein ...		Potri.006G028900 [exp]	5.38	0.9458
AT3G13610			2-oxoglutarate (2OG) and Fe(II...		Potri.001G006800 [exp]	5.47	0.9924
AT1G65570			Pectin lyase-like superfamily ...		Potri.010G177501 [exp]	6.63	0.9836
AT4G35270		NLP2	Plant regulator RWP-RK family ...		Potri.009G166666 [exp]	11.83	0.9663
AT3G12900			2-oxoglutarate (2OG) and Fe(II...		Potri.005G097900 [exp]	12.40	0.9794
AT4G19690		ATIRT1, IRT1	ARABIDOPSIS IRON-REGULATED TRA...		Potri.015G117900 [exp]	13.26	0.9793	Pt-ZIP6.4
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.005G181100 [exp]	14.38	0.9783	Pt-NRAMP1.4
AT5G04950		ATNAS1	ARABIDOPSIS THALIANA NICOTIANA...		Potri.004G193400 [exp]	14.45	0.9773
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.005G181000 [exp]	15.81	0.9781

Compare expression of checked genes

Potri.001G006750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.