Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13610 370 / 4e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G55290 359 / 1e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G12900 276 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G12270 226 / 1e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 140 / 2e-39 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06620 140 / 3e-39 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G43440 134 / 2e-37 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G59530 134 / 7e-37 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G03400 132 / 3e-36 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G03410 132 / 5e-36 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G006901 [exp] 546 / 0 AT3G13610 520 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G007100 [exp] 464 / 5e-166 AT1G55290 496 / 4e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G097900 [exp] 272 / 3e-90 AT3G12900 471 / 4e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 143 / 2e-40 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.015G002800 [exp] 138 / 1e-38 AT5G24530 521 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G136000 [exp] 134 / 4e-37 AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.012G006300 [exp] 133 / 7e-37 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150100 [exp] 133 / 8e-37 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G231500 [exp] 134 / 1e-36 AT2G36690 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036082 [exp] 290 / 1e-97 AT1G55290 395 / 2e-137 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10007818 [exp] 140 / 5e-39 AT1G03400 315 / 9e-106 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014398 [exp] 136 / 2e-37 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023890 [exp] 135 / 4e-37 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10030185 [exp] 128 / 1e-34 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022191 [exp] 127 / 2e-34 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022196 [exp] 127 / 4e-34 AT5G59530 420 / 5e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10001109 [exp] 126 / 5e-34 AT1G06620 379 / 4e-131 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10004808 [exp] 125 / 7e-34 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022415 [exp] 126 / 1e-33 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.001G006800.2 pacid=42788651 polypeptide=Potri.001G006800.2.p locus=Potri.001G006800 ID=Potri.001G006800.2.v4.1 annot-version=v4.1 ATGGCTCCAACACTTGCAGTGTCATTCAATGACTCCTCAGATATCACTGATTTTTTCCTGAACAAAGGCAATGGAGTAAAGGGTCTCTCCGAGATGGGCC TCGAAAGCCTCCCCAAGCAATATATCCAACCCCTTGAGGAAAGAATGTGTGGTACCAAAATCATGTCCCATGAATCCATTCCCATCATTGACATGTCAAA ATGGGATGACCCTAAAGTTGCTGAAGCAATCTGTGAGGCTGCAGAGAAATGGGGATTCTTCCAGATTATTAACCATGGAGTTCCCATTGAAGTACTTGAG AATGTTAAGGAAGCAACTCATCAGTTCTTCAGATTACCAGCAGAGGAAAAGAGGAAGTATTTAAAAGAGTTTTCTCCTTCTAACAACGTGCGGTTTGGCA CAAGCTTTAGTCCTGAAGCTGAGAAGGCTTTAGAGTGGAAAGATTACCTTAGTCTCTTTTATGTCTCCGAGGATGAGGCTTCTGCATTGTGGCCTGCGGT TTGCAAGGATCAAGTGCTGGAGTACATGAAGAGATCAGAAACTGTTATCAGAAAGCTACTGGATGTGCTAATGAAGAATCTGAATGTGACTGAGATCGAT GAGACAAAAGAATCCCTCTTAATGGGGTCTAAAAGGACTAACCTTAACTACTATCCGATTTGTCCAAACCCTGCTGAGCTCACTGTAGGAGTTGGCCGCC ACTCGGATGTCTCAACACTCACTTTCCTCCTCCAAGATGACATCGGTGGACTTTACGTGCGAGGGAACAATGATAGCTGGATTCATGTTCCTCCTGTTAG CGGTCCATTGTGA
AA sequence Show only first row Show all	>Potri.001G006800.2 pacid=42788651 polypeptide=Potri.001G006800.2.p locus=Potri.001G006800 ID=Potri.001G006800.2.v4.1 annot-version=v4.1 MAPTLAVSFNDSSDITDFFLNKGNGVKGLSEMGLESLPKQYIQPLEERMCGTKIMSHESIPIIDMSKWDDPKVAEAICEAAEKWGFFQIINHGVPIEVLE NVKEATHQFFRLPAEEKRKYLKEFSPSNNVRFGTSFSPEAEKALEWKDYLSLFYVSEDEASALWPAVCKDQVLEYMKRSETVIRKLLDVLMKNLNVTEID ETKESLLMGSKRTNLNYYPICPNPAELTVGVGRHSDVSTLTFLLQDDIGGLYVRGNNDSWIHVPPVSGPL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G13610			2-oxoglutarate (2OG) and Fe(II...		Potri.001G006800 [exp]	0	1
AT3G13610			2-oxoglutarate (2OG) and Fe(II...		Potri.001G006901 [exp]	2.00	0.9989
AT1G65570			Pectin lyase-like superfamily ...		Potri.010G177501 [exp]	3.00	0.9929
AT3G12900			2-oxoglutarate (2OG) and Fe(II...		Potri.005G097900 [exp]	4.24	0.9962
AT4G19690		ATIRT1, IRT1	ARABIDOPSIS IRON-REGULATED TRA...		Potri.015G117900 [exp]	4.89	0.9959	Pt-ZIP6.4
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.005G181100 [exp]	5.47	0.9958	Pt-NRAMP1.4
AT3G13610			2-oxoglutarate (2OG) and Fe(II...		Potri.001G006750 [exp]	5.47	0.9924
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.005G181000 [exp]	7.48	0.9947
AT1G65570			Pectin lyase-like superfamily ...		Potri.010G177601 [exp]	10.19	0.9904
AT1G11925			Stigma-specific Stig1 family p...		Potri.011G009100 [exp]	10.24	0.9861
AT1G31260		ZIP10	zinc transporter 10 precursor ...		Potri.015G117700 [exp]	10.90	0.9850

Compare expression of checked genes

Potri.001G006800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.