Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55290 496 / 4e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G13610 489 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G12900 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G12270 317 / 2e-106 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 197 / 5e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06620 194 / 1e-58 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 192 / 5e-58 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G61400 189 / 7e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G55970 188 / 1e-56 ATJRG21 jasmonate-regulated gene 21 (.1) AT1G03410 189 / 2e-56 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G006901 [exp] 624 / 0 AT3G13610 520 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G006800 [exp] 464 / 5e-166 AT3G13610 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G097900 [exp] 378 / 1e-130 AT3G12900 471 / 4e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G107500 [exp] 216 / 1e-66 AT1G03400 302 / 3e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150100 [exp] 204 / 1e-62 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 203 / 2e-62 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.015G002800 [exp] 198 / 1e-60 AT5G24530 521 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.012G006300 [exp] 195 / 2e-59 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073100 [exp] 192 / 1e-57 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036082 [exp] 400 / 3e-139 AT1G55290 395 / 2e-137 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10007818 [exp] 199 / 2e-60 AT1G03400 315 / 9e-106 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014398 [exp] 189 / 1e-56 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023890 [exp] 187 / 1e-55 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10011981 [exp] 186 / 1e-55 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1) Lus10030185 [exp] 186 / 1e-55 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10011980 [exp] 185 / 2e-55 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1) Lus10004808 [exp] 182 / 3e-54 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022415 [exp] 182 / 3e-54 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032930 [exp] 181 / 7e-54 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.001G007100.1 pacid=42793660 polypeptide=Potri.001G007100.1.p locus=Potri.001G007100 ID=Potri.001G007100.1.v4.1 annot-version=v4.1 ATGGCTCCAACTGCTGCAGTGTTAATCAATGGCTCCTCGGATGCCATCACTGATTTTGTCCTGAAACAAGGTAATGGAGTAAAGGGACTCTCGGAAATGG GCCTCAAAGACCTCCCTAAACAGTACATCCAACCCCTCGAGGAAATAATCAGTGATGCCAAAATCATGCCCCAGGCATCCATTCCCATCATTGACGTGTC AAAACTGGACGGCCCAACAGTTGCAGAAGCGGTCTGTAGGGCTGCAGAAAGATGGGGTTTCTTTCAGATTATTAACCATGGGGTTCCCATTGATGTACTT GAGAATGTCAAGGAATCAACTCATCGGTTCTTCGGGTTACCAGCAGAGGAAAAGAGGAAGTATTTAAAAGAGCTTTCTCCTTCTAACAACGTGCGGTTTG GCACAAGCTTTAGTCCTGAAGCTGAGAAGGCTTTAGAGTGGAAGGATTACCTTAGCCTCTTTTATGTCTCTGAGGACGAGGCTTCTGCTTTGTGGCCCTC TGTTTGCAAGGATCAGGTGCTAGACTACATGAGGAGATCAGAAATTGTTATCAGAAGGTTACTCGATGTGTTAATGAAGAATCTGAAAGTGACTGAGATT GATGAGACAAAAGAATCCCTCTTAATGGGGTCTAAGAGGATTAACCTTAACTACTATCCGATTTGTCCAAACCCTGAGCTCACAGTAGGAATTGGCCGCC ACTCGGATGTCTCAACACTCACAGTCCTCCTCCAAGATGACGTTGGTGGACTTTACGTCCGAGGAGATGACGATTACTGGATTCATGTTCCTCCTGTTAA CGGTTCCCTTGTGATCAATGTTGGTGATGCTCTACAAATAATGAGCAATGGTCGATACAAGAGTGTTGAGCACTGCGTGATGACCGATGGAAGTAAGAAC AGGATTTCAATCCCCATATTCATCAACCCAAGGCCATCAAACAAAATATCTCCTTTTCATGAAGTGCTGGCAAGCGGCGAGAAGGCAGCGTATAAGGAAG TTCTGTACTCGGATTACGTCAAGCATTTCTTCCGAAAGGCACATGATGGGAAGAAAACAATCGATTTCGCTAAGATAAGAATATGA
AA sequence Show only first row Show all	>Potri.001G007100.1 pacid=42793660 polypeptide=Potri.001G007100.1.p locus=Potri.001G007100 ID=Potri.001G007100.1.v4.1 annot-version=v4.1 MAPTAAVLINGSSDAITDFVLKQGNGVKGLSEMGLKDLPKQYIQPLEEIISDAKIMPQASIPIIDVSKLDGPTVAEAVCRAAERWGFFQIINHGVPIDVL ENVKESTHRFFGLPAEEKRKYLKELSPSNNVRFGTSFSPEAEKALEWKDYLSLFYVSEDEASALWPSVCKDQVLDYMRRSEIVIRRLLDVLMKNLKVTEI DETKESLLMGSKRINLNYYPICPNPELTVGIGRHSDVSTLTVLLQDDVGGLYVRGDDDYWIHVPPVNGSLVINVGDALQIMSNGRYKSVEHCVMTDGSKN RISIPIFINPRPSNKISPFHEVLASGEKAAYKEVLYSDYVKHFFRKAHDGKKTIDFAKIRI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G55290			2-oxoglutarate (2OG) and Fe(II...		Potri.001G007100 [exp]	0	1
AT3G23600			alpha/beta-Hydrolases superfam...		Potri.017G048100 [exp]	2.00	0.9067
AT4G13090		XTH2	xyloglucan endotransglucosylas...		Potri.002G244200 [exp]	7.21	0.8675	Pt-XTH2.1
					Potri.004G022300 [exp]	13.78	0.8500
AT1G01720	NAC	ATAF1, ANAC002	Arabidopsis NAC domain contain...		Potri.009G052300 [exp]	18.22	0.6763
AT3G18010	HD	WOX1	WUSCHEL related homeobox 1 (.1...		Potri.010G111400 [exp]	24.49	0.8088
AT5G01600		ATFER1	ARABIDOPSIS THALIANA FERRETIN ...		Potri.006G103900 [exp]	35.77	0.7726
AT2G46950		CYP709B2	"cytochrome P450, family 709, ...		Potri.006G022200 [exp]	35.94	0.7671	Pt-CYP709.2
AT5G53980	HD	ATHB52	homeobox protein 52 (.1)		Potri.011G114500 [exp]	38.01	0.7708
AT2G37030			SAUR-like auxin-responsive pro...		Potri.008G037900 [exp]	38.41	0.7708	SAUR40
AT4G34770			SAUR-like auxin-responsive pro...		Potri.004G165600 [exp]	43.49	0.7621

Compare expression of checked genes

Potri.001G007100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.