Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26110 44 / 9e-07 Protein of unknown function (DUF761) (.1) AT1G61260 43 / 4e-06 Protein of unknown function (DUF761) (.1) AT5G47920 41 / 9e-06 unknown protein AT1G15385 36 / 0.0002 unknown protein AT4G14380 37 / 0.0003 unknown protein AT1G30190 37 / 0.0004 unknown protein AT5G54300 37 / 0.0005 Protein of unknown function (DUF761) (.1) AT5G57510 36 / 0.0007 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G008080 [exp] 105 / 9e-32 AT2G26110 44 / 2e-06 Protein of unknown function (DUF761) (.1) Potri.003G217500 [exp] 102 / 1e-30 ND / Potri.003G217600 [exp] 63 / 8e-15 ND / Potri.001G171701 [exp] 46 / 3e-08 AT1G15385 53 / 7e-11 unknown protein Potri.003G062300 [exp] 44 / 3e-07 AT1G15385 58 / 8e-13 unknown protein Potri.001G406600 [exp] 45 / 8e-07 AT1G61260 192 / 1e-58 Protein of unknown function (DUF761) (.1) Potri.011G044000 [exp] 42 / 4e-06 AT1G61260 227 / 7e-72 Protein of unknown function (DUF761) (.1) Potri.018G053000 [exp] 41 / 1e-05 AT2G26110 167 / 2e-49 Protein of unknown function (DUF761) (.1) Potri.014G140000 [exp] 41 / 2e-05 AT5G47920 114 / 1e-31 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026978 [exp] 46 / 2e-07 AT2G26110 122 / 2e-33 Protein of unknown function (DUF761) (.1) Lus10019517 [exp] 45 / 5e-07 AT2G26110 148 / 5e-43 Protein of unknown function (DUF761) (.1) Lus10000281 [exp] 44 / 2e-06 AT5G47920 76 / 5e-17 unknown protein Lus10024988 [exp] 42 / 5e-06 AT2G26110 172 / 1e-51 Protein of unknown function (DUF761) (.1) Lus10002566 [exp] 42 / 8e-06 AT5G47920 79 / 3e-18 unknown protein Lus10011239 [exp] 40 / 4e-05 AT1G11220 232 / 1e-73 Protein of unknown function (DUF761) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05553 [poplar] [flax] DUF761 Cotton fibre expressed protein
Representative CDS sequence Show only first row Show all	>Potri.001G008160.1 pacid=42788740 polypeptide=Potri.001G008160.1.p locus=Potri.001G008160 ID=Potri.001G008160.1.v4.1 annot-version=v4.1 ATGGAACGCCATAAAGAAGTTGCTAAGCATGATGGTCTTAACATAGATGACAGGAAAAGTGATGGAAGGAGGAAAACGAGGATGCGAAACTGGTTGGTTG TGGAGGACGCTTGGGAAGATATAAATGAGAAGGCTGATGCTTTCATTAAGAACTTCCGCAATCAACTAAAGATTCAACGCCAAGATTCGCTTAAACGCTT CCAGGAGATGATCTCCCGGGGAGCTTAA
AA sequence Show only first row Show all	>Potri.001G008160.1 pacid=42788740 polypeptide=Potri.001G008160.1.p locus=Potri.001G008160 ID=Potri.001G008160.1.v4.1 annot-version=v4.1 MERHKEVAKHDGLNIDDRKSDGRRKTRMRNWLVVEDAWEDINEKADAFIKNFRNQLKIQRQDSLKRFQEMISRGA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G26110			Protein of unknown function (D...		Potri.001G008160 [exp]	0	1
AT2G42320			nucleolar protein gar2-related...		Potri.016G051500 [exp]	1.41	0.9052
AT5G09360		LAC14	laccase 14 (.1)		Potri.001G206200 [exp]	2.44	0.8921
AT3G22600			Bifunctional inhibitor/lipid-t...		Potri.002G050500 [exp]	3.31	0.8649
AT3G21550		AtDMP2	Arabidopsis thaliana DUF679 do...		Potri.008G115100 [exp]	3.46	0.8852
AT5G57090		MM31, ATPIN2, A...	WAVY ROOTS 6, ETHYLENE INSENSI...		Potri.001G205200 [exp]	5.91	0.8865	Pt-PIN2.1,PIN10
					Potri.003G152500 [exp]	6.00	0.8880
AT3G08650			ZIP metal ion transporter fami...		Potri.006G111200 [exp]	7.54	0.8433
					Potri.019G038310 [exp]	8.48	0.8779
AT3G30387			Protein of unknown function (D...		Potri.017G029250 [exp]	13.74	0.8379
AT1G16390		3-Oct, ATOCT3	organic cation/carnitine trans...		Potri.010G174400 [exp]	14.07	0.8438

Compare expression of checked genes

Potri.001G008160 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.