Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55265 137 / 9e-42 Protein of unknown function, DUF538 (.1) AT1G61667 115 / 3e-33 Protein of unknown function, DUF538 (.1) AT5G19860 104 / 7e-29 Protein of unknown function, DUF538 (.1) AT5G54530 103 / 2e-28 Protein of unknown function, DUF538 (.1) AT3G07460 86 / 2e-21 Protein of unknown function, DUF538 (.1.2) AT1G02813 82 / 2e-20 Protein of unknown function, DUF538 (.1) AT3G07470 82 / 5e-20 Protein of unknown function, DUF538 (.1) AT5G16380 77 / 5e-18 Protein of unknown function, DUF538 (.1) AT4G02360 64 / 4e-13 Protein of unknown function, DUF538 (.1) AT5G19590 59 / 2e-11 Protein of unknown function, DUF538 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G008320 [exp] 251 / 7e-87 AT1G55265 135 / 4e-41 Protein of unknown function, DUF538 (.1) Potri.003G217300 [exp] 227 / 3e-77 AT1G55265 139 / 2e-42 Protein of unknown function, DUF538 (.1) Potri.001G008400 [exp] 112 / 4e-32 AT5G19860 205 / 5e-68 Protein of unknown function, DUF538 (.1) Potri.003G217200 [exp] 111 / 1e-31 AT5G19860 196 / 1e-64 Protein of unknown function, DUF538 (.1) Potri.001G410300 [exp] 100 / 3e-27 AT5G54530 179 / 2e-58 Protein of unknown function, DUF538 (.1) Potri.011G129900 [exp] 97 / 4e-26 AT5G54530 181 / 6e-59 Protein of unknown function, DUF538 (.1) Potri.004G029600 [exp] 94 / 7e-25 AT1G61667 175 / 8e-57 Protein of unknown function, DUF538 (.1) Potri.011G032600 [exp] 91 / 1e-23 AT1G61667 177 / 1e-57 Protein of unknown function, DUF538 (.1) Potri.014G177800 [exp] 88 / 4e-22 AT3G07470 192 / 3e-63 Protein of unknown function, DUF538 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039182 [exp] 170 / 1e-54 AT1G55265 135 / 1e-40 Protein of unknown function, DUF538 (.1) Lus10013756 [exp] 170 / 1e-54 AT1G55265 137 / 2e-41 Protein of unknown function, DUF538 (.1) Lus10013752 [exp] 121 / 3e-35 AT5G19860 194 / 1e-63 Protein of unknown function, DUF538 (.1) Lus10039187 [exp] 120 / 6e-35 AT5G19860 190 / 4e-62 Protein of unknown function, DUF538 (.1) Lus10020075 [exp] 107 / 9e-30 AT1G61667 178 / 6e-58 Protein of unknown function, DUF538 (.1) Lus10006749 [exp] 97 / 7e-26 AT1G61667 171 / 2e-55 Protein of unknown function, DUF538 (.1) Lus10025861 [exp] 97 / 3e-25 AT3G07470 171 / 4e-54 Protein of unknown function, DUF538 (.1) Lus10038238 [exp] 96 / 3e-25 AT3G07460 162 / 4e-51 Protein of unknown function, DUF538 (.1.2) Lus10018396 [exp] 95 / 4e-25 AT1G61667 176 / 5e-57 Protein of unknown function, DUF538 (.1) Lus10007617 [exp] 92 / 5e-24 AT1G61667 175 / 8e-57 Protein of unknown function, DUF538 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04398 [poplar] [flax] DUF538 Protein of unknown function, DUF538
Representative CDS sequence Show only first row Show all	>Potri.001G008240.1 pacid=42787791 polypeptide=Potri.001G008240.1.p locus=Potri.001G008240 ID=Potri.001G008240.1.v4.1 annot-version=v4.1 ATGGCTTCCTTCAACATCGTCGCAGTACTCTCTCTCTACCTTCTCTCTCTACTCCTCTTATCAAAAACCCGTCTTTCTCTCTCCCTAACCACCTCAGATA TCCATGATCTTCTTCCTCAATATGGCCTGCCTCGTGGCTTACTCCCAGACAACGTGGAATCCTACACGCTACCATCATCTGATGGGTCTTTTGAAGTCAA ACTTAAGACCCCGTGTTATGTTCACTTTGATGATGTTGTGTACTATGATAAAGTAATCAAAGGGAAGTTGAGTTACGGCTCTGTGCATGATGTGTCAGGG ATTCAAGCAAAGAAGCTTTTTATTTGGTTGCCAGTTACTGGGATTGAAGTTAGTAAGGCTGATGATGGTATGATTAGTTTCTTTGTTGGTCCGATTTCCG AGGAGTTGCCTGCTAAGCAATTTGAGGATGTTCCTGCTTGTAAGAAGAAGGTTGGTGGGCTAATGACAGATTTGGAGTCCATGTGA
AA sequence Show only first row Show all	>Potri.001G008240.1 pacid=42787791 polypeptide=Potri.001G008240.1.p locus=Potri.001G008240 ID=Potri.001G008240.1.v4.1 annot-version=v4.1 MASFNIVAVLSLYLLSLLLLSKTRLSLSLTTSDIHDLLPQYGLPRGLLPDNVESYTLPSSDGSFEVKLKTPCYVHFDDVVYYDKVIKGKLSYGSVHDVSG IQAKKLFIWLPVTGIEVSKADDGMISFFVGPISEELPAKQFEDVPACKKKVGGLMTDLESM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G55265			Protein of unknown function, D...		Potri.001G008240 [exp]	0	1
AT4G39090		EMB3005, RD19A,...	RESPONSIVE TO DEHYDRATION 19A,...		Potri.004G160300 [exp]	1.00	0.7771	RD19.3
AT4G34640		ERG9, SQS1	squalene synthase 1 (.1)		Potri.004G161200 [exp]	5.29	0.6449
AT1G16180			Serinc-domain containing serin...		Potri.003G186500 [exp]	6.70	0.6565
AT1G68090		ANN5, ANNAT5	ANNEXIN ARABIDOPSIS THALIANA 5...		Potri.015G031800 [exp]	6.92	0.6590	Pt-NANN.2
AT3G06170			Serinc-domain containing serin...		Potri.008G201900 [exp]	7.34	0.6683
AT4G09830			Uncharacterised conserved prot...		Potri.002G064800 [exp]	13.41	0.6537
AT1G76390		PUB43	plant U-box 43, ARM repeat sup...		Potri.002G007800 [exp]	17.49	0.6098
AT4G01370		ATMPK4	MAP kinase 4 (.1)		Potri.003G131800 [exp]	22.84	0.5879	MMK3.1
AT1G02816			Protein of unknown function, D...		Potri.014G127600 [exp]	26.32	0.5645
AT1G11910		ATAPA1, APA1	aspartic proteinase A1 (.1)		Potri.001G356900 [exp]	28.39	0.5680	SOYAP4.1

Compare expression of checked genes

Potri.001G008240 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.