Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55265 135 / 4e-41 Protein of unknown function, DUF538 (.1) AT1G61667 108 / 1e-30 Protein of unknown function, DUF538 (.1) AT5G19860 104 / 7e-29 Protein of unknown function, DUF538 (.1) AT5G54530 99 / 1e-26 Protein of unknown function, DUF538 (.1) AT3G07460 84 / 1e-20 Protein of unknown function, DUF538 (.1.2) AT1G02813 80 / 2e-19 Protein of unknown function, DUF538 (.1) AT3G07470 79 / 5e-19 Protein of unknown function, DUF538 (.1) AT5G16380 74 / 5e-17 Protein of unknown function, DUF538 (.1) AT4G02360 64 / 3e-13 Protein of unknown function, DUF538 (.1) AT2G03350 59 / 4e-11 Protein of unknown function, DUF538 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G008240 [exp] 251 / 7e-87 AT1G55265 137 / 8e-42 Protein of unknown function, DUF538 (.1) Potri.003G217300 [exp] 222 / 2e-75 AT1G55265 139 / 2e-42 Protein of unknown function, DUF538 (.1) Potri.001G008400 [exp] 110 / 3e-31 AT5G19860 205 / 5e-68 Protein of unknown function, DUF538 (.1) Potri.003G217200 [exp] 108 / 2e-30 AT5G19860 196 / 1e-64 Protein of unknown function, DUF538 (.1) Potri.001G410300 [exp] 97 / 6e-26 AT5G54530 179 / 2e-58 Protein of unknown function, DUF538 (.1) Potri.011G129900 [exp] 92 / 4e-24 AT5G54530 181 / 6e-59 Protein of unknown function, DUF538 (.1) Potri.004G029600 [exp] 89 / 6e-23 AT1G61667 175 / 8e-57 Protein of unknown function, DUF538 (.1) Potri.014G177800 [exp] 85 / 3e-21 AT3G07470 192 / 3e-63 Protein of unknown function, DUF538 (.1) Potri.002G238900 [exp] 84 / 9e-21 AT3G07470 193 / 1e-63 Protein of unknown function, DUF538 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039182 [exp] 166 / 4e-53 AT1G55265 135 / 1e-40 Protein of unknown function, DUF538 (.1) Lus10013756 [exp] 166 / 4e-53 AT1G55265 137 / 2e-41 Protein of unknown function, DUF538 (.1) Lus10013752 [exp] 116 / 2e-33 AT5G19860 194 / 1e-63 Protein of unknown function, DUF538 (.1) Lus10039187 [exp] 115 / 4e-33 AT5G19860 190 / 4e-62 Protein of unknown function, DUF538 (.1) Lus10020075 [exp] 101 / 1e-27 AT1G61667 178 / 6e-58 Protein of unknown function, DUF538 (.1) Lus10038238 [exp] 94 / 2e-24 AT3G07460 162 / 4e-51 Protein of unknown function, DUF538 (.1.2) Lus10006749 [exp] 93 / 2e-24 AT1G61667 171 / 2e-55 Protein of unknown function, DUF538 (.1) Lus10025861 [exp] 95 / 3e-24 AT3G07470 171 / 4e-54 Protein of unknown function, DUF538 (.1) Lus10018396 [exp] 92 / 6e-24 AT1G61667 176 / 5e-57 Protein of unknown function, DUF538 (.1) Lus10007617 [exp] 89 / 7e-23 AT1G61667 175 / 8e-57 Protein of unknown function, DUF538 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04398 [poplar] [flax] DUF538 Protein of unknown function, DUF538
Representative CDS sequence Show only first row Show all	>Potri.001G008320.1 pacid=42791338 polypeptide=Potri.001G008320.1.p locus=Potri.001G008320 ID=Potri.001G008320.1.v4.1 annot-version=v4.1 ATGGCTTCCTTCAACATCCTCACTCTCTCTCTCTACCTTCTCTCTCTACTCCTCTTATCAAAAATCCGTCTTTCTCTCTCCCTAACCACCTCAGATATCC ATGATCTTCTTCCTCAATATGGCCTGCCACGTGGCTTGCTCCCCGACAATGTGGAATCCTTCACTCTACCATCATCTGATGGGTCTTTTGAAGTCAAATT TAAGACCCCGTGTTATGTTCACTTTGATGATGTTGTGTACTATGATAAAGTAATCAAAGGGAAGTTGAGTTATGGTTCTGTGCATGATGTGTCAGGGATT CAAGCAAAGAAGCTCTTTGTTTGGTTGCCAGTTACTGGGATTGAAGTTAGTAAGGCTGATGATAGTATGATTAGTTTCTTTGTTGGCCCGATTTCCCGCG AGTTGCCTGCTAAGCAGTTCGAGGATGTTCCTGCTTGTAAGAGGAAGGTTGGTGGGCTAAGGACATATTTGGAGTCGATGTGA
AA sequence Show only first row Show all	>Potri.001G008320.1 pacid=42791338 polypeptide=Potri.001G008320.1.p locus=Potri.001G008320 ID=Potri.001G008320.1.v4.1 annot-version=v4.1 MASFNILTLSLYLLSLLLLSKIRLSLSLTTSDIHDLLPQYGLPRGLLPDNVESFTLPSSDGSFEVKFKTPCYVHFDDVVYYDKVIKGKLSYGSVHDVSGI QAKKLFVWLPVTGIEVSKADDSMISFFVGPISRELPAKQFEDVPACKRKVGGLRTYLESM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G55265			Protein of unknown function, D...		Potri.001G008320 [exp]	0	1
AT1G22040			Galactose oxidase/kelch repeat...		Potri.005G170000 [exp]	3.00	0.7028
AT1G11020			RING/FYVE/PHD zinc finger supe...		Potri.018G073400 [exp]	3.87	0.7159
AT5G40670			PQ-loop repeat family protein ...		Potri.017G070300 [exp]	4.00	0.7316
AT1G11020			RING/FYVE/PHD zinc finger supe...		Potri.006G154800 [exp]	10.67	0.7400
AT3G13080		EST2, ATMRP3, A...	MULTIDRUG RESISTANCE PROTEIN 3...		Potri.018G149700 [exp]	12.00	0.7101
AT1G27980		DPL1, ATDPL1	dihydrosphingosine phosphate l...		Potri.003G168800 [exp]	12.96	0.7410
					Potri.003G010800 [exp]	14.28	0.6935
AT1G36380			unknown protein		Potri.005G171000 [exp]	16.58	0.7430
AT4G35860		ATGB2, AtRABB1b...	GTP-binding 2 (.1.2)		Potri.009G159600 [exp]	22.91	0.6683	Pt-ATGB2.1
AT1G16180			Serinc-domain containing serin...		Potri.003G186500 [exp]	23.49	0.6528

Compare expression of checked genes

Potri.001G008320 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.