Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44290 156 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G55260 151 / 5e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G44300 149 / 1e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G58550 114 / 4e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73890 63 / 3e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G27950 59 / 6e-11 LTPG1 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) AT1G03103 59 / 7e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 58 / 8e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G48130 53 / 1e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G64080 52 / 2e-08 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G217000 [exp] 292 / 3e-102 AT1G55260 149 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G232000 [exp] 159 / 2e-49 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G195700 [exp] 146 / 9e-45 AT2G44290 145 / 6e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G172400 [exp] 65 / 4e-13 AT1G27950 145 / 5e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.015G054000 [exp] 64 / 2e-12 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G053700 [exp] 64 / 2e-12 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 57 / 2e-10 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G056200 [exp] 54 / 7e-09 AT1G27950 149 / 1e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.008G155100 [exp] 52 / 1e-08 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042449 [exp] 156 / 5e-48 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026220 [exp] 139 / 5e-40 AT2G44300 131 / 6e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10035975 [exp] 120 / 4e-32 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1) Lus10017749 [exp] 96 / 1e-24 AT2G44290 115 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033076 [exp] 95 / 2e-24 AT2G44290 114 / 6e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032488 [exp] 67 / 8e-14 AT1G73890 84 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042984 [exp] 65 / 3e-13 AT1G73890 81 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10015779 [exp] 56 / 9e-10 AT1G27950 144 / 8e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10037027 [exp] 54 / 3e-09 AT1G27950 147 / 3e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10010572 [exp] 54 / 4e-09 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.001G008500.1 pacid=42789750 polypeptide=Potri.001G008500.1.p locus=Potri.001G008500 ID=Potri.001G008500.1.v4.1 annot-version=v4.1 ATGGGCTCAGAAGGTCTTGTGACTGCTTCAGCAATTCCATGCATCTTGGTGCTGTTGATGCTGGTTGGCACTGCAAGATCAGACTTTCAGCAAGATAGAA CAGAGTGTGCAGACCAACTAGTAGGTCTAGCCACATGTCTTCCATATGTTGGTGGTGATGCTAAGGCACCCACCATAGATTGCTGTAGTGGGCTTAAACA AGTGTTAGATAAGAGTGTGAAATGTCTGTGTGTCCTCATTAAAGATCGTGACAACCCTGATCTTGGTATCAAGTTCAATGTTAGTCTTGTTGCTAAACTT CCTAGCTTGTGCCATGCGCCAGTTAATGTCACAAACTGCATCGATATTCTGCACCTGCCTGCTGGCTCACCGGATGCGAAGGTCTTTGCAGGATTTGCCA ACATCACCGGAAGTGTTGCTGCCCCAGTTGCCAGTGCGAACTCAACTGGCAGTAAATCAAGCACTGCTGCAGAAAAGAGTGGTGCTGAGAGGCCAGCAAA CAGATGGCTTGTAGCAGCGGAGGTTCTGTGTGGATTATTACTATGGACTTTCACATCTTTTGGTGTCTGA
AA sequence Show only first row Show all	>Potri.001G008500.1 pacid=42789750 polypeptide=Potri.001G008500.1.p locus=Potri.001G008500 ID=Potri.001G008500.1.v4.1 annot-version=v4.1 MGSEGLVTASAIPCILVLLMLVGTARSDFQQDRTECADQLVGLATCLPYVGGDAKAPTIDCCSGLKQVLDKSVKCLCVLIKDRDNPDLGIKFNVSLVAKL PSLCHAPVNVTNCIDILHLPAGSPDAKVFAGFANITGSVAAPVASANSTGSKSSTAAEKSGAERPANRWLVAAEVLCGLLLWTFTSFGV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G44290			Bifunctional inhibitor/lipid-t...		Potri.001G008500 [exp]	0	1
AT1G72210	bHLH	bHLH096	basic helix-loop-helix (bHLH) ...		Potri.005G039800 [exp]	18.60	0.7445
AT1G71970			unknown protein		Potri.013G111700 [exp]	29.15	0.7161
AT5G02530			RNA-binding (RRM/RBD/RNP motif...		Potri.008G052601 [exp]	46.45	0.6459
AT3G02700			NC domain-containing protein-r...		Potri.004G078700 [exp]	56.78	0.6804
AT1G69080			Adenine nucleotide alpha hydro...		Potri.010G140200 [exp]	58.80	0.7014
AT2G33310	AUX_IAA	IAA13	auxin-induced protein 13 (.1.2...		Potri.010G065200 [exp]	75.77	0.7008
AT1G13700		PGL1	6-phosphogluconolactonase 1 (....		Potri.010G157200 [exp]	95.10	0.6826
AT1G78815		LSH7	LIGHT SENSITIVE HYPOCOTYLS 7, ...		Potri.001G390900 [exp]	111.17	0.6593
AT1G12845			unknown protein		Potri.017G060400 [exp]	133.90	0.6532
AT3G23805		RALFL24	ralf-like 24 (.1)		Potri.001G320700 [exp]	135.75	0.6665

Compare expression of checked genes

Potri.001G008500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.