Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58170 238 / 8e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G55210 228 / 1e-76 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT5G49040 223 / 7e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13650 218 / 6e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49030 197 / 3e-58 OVA2 ovule abortion 2, tRNA synthetase class I (I, L, M and V) family protein (.1), tRNA synthetase class I (I, L, M and V) family protein (.2), tRNA synthetase class I (I, L, M and V) family protein (.3) AT1G65870 179 / 2e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13662 173 / 3e-55 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 166 / 2e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 163 / 3e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13660 160 / 7e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G216200 [exp] 323 / 3e-114 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.003G216300 [exp] 263 / 1e-90 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.003G216400 [exp] 262 / 5e-90 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G061000 [exp] 254 / 5e-87 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.006G195300 [exp] 235 / 2e-79 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060900 [exp] 226 / 5e-76 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 221 / 8e-74 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060801 [exp] 194 / 1e-63 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 184 / 3e-59 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026176 [exp] 239 / 6e-81 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10042488 [exp] 234 / 4e-79 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10029306 [exp] 225 / 2e-75 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 216 / 4e-72 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10030483 [exp] 195 / 2e-63 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021084 [exp] 174 / 3e-55 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10039561 [exp] 170 / 1e-53 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10016237 [exp] 165 / 1e-52 AT1G58170 149 / 6e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034476 [exp] 159 / 2e-49 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10027834 [exp] 156 / 6e-48 AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [poplar] [flax] AOC_barrel PF03018 [poplar] [flax] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Potri.001G009100.1 pacid=42790846 polypeptide=Potri.001G009100.1.p locus=Potri.001G009100 ID=Potri.001G009100.1.v4.1 annot-version=v4.1 ATGGCTAGATCAGTTCCCATCCTTGCTTCCAAATTCATCACTCTCTTACTCCTCTCTTCCTTTGCCACAATCTTGGTCACTGGAGACCAGGATCATGAAT TTGTGAGAAGTTTGGACAGGAAGCTACTAGGGCTCAAGAAAGAAAAGCTAAGCCACTTCAAGTTATATTGGCATGACATCCTTACTGGCCAGAACCCCAG CGCCGTCCAAGTTGTGCCACCACCATCGAACACATCAAGAACAGCTTTTGGGTTAGTGAGAATGATCGATAACCCATTAACCTTAGGGCCTGAAATGAGC TCAAAGTTGGTAGGAAGGGCACAAGGGTTGTATGCACAAGCGTCGCAACAAGATATTGGGTTATTGATGGCCATGAACTTTGCTTTTATTGAAGGTAAGT ATAATGGTAGCACTATTACTGTTCTAGGGAAGAACGCAGTGTTCTCGACGGTGAGAGAGATGCCGGTGATCGGAGGAAGCGGACTTTTCCGGTTTGCTAG AGGTTATGTTCAGGCGAGAACTCACAAGCTCGACATGGCCACAGGAGACGCTACAGTTGAGTATAATGTCTACGTTTTTCATTATTGA
AA sequence Show only first row Show all	>Potri.001G009100.1 pacid=42790846 polypeptide=Potri.001G009100.1.p locus=Potri.001G009100 ID=Potri.001G009100.1.v4.1 annot-version=v4.1 MARSVPILASKFITLLLLSSFATILVTGDQDHEFVRSLDRKLLGLKKEKLSHFKLYWHDILTGQNPSAVQVVPPPSNTSRTAFGLVRMIDNPLTLGPEMS SKLVGRAQGLYAQASQQDIGLLMAMNFAFIEGKYNGSTITVLGKNAVFSTVREMPVIGGSGLFRFARGYVQARTHKLDMATGDATVEYNVYVFHY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G58170			Disease resistance-responsive ...		Potri.001G009100 [exp]	0	1
AT2G36880		MAT3	methionine adenosyltransferase...		Potri.006G123200 [exp]	6.40	0.8937	AdoMet6
AT5G26780		SHM2	serine hydroxymethyltransferas...		Potri.002G109200 [exp]	10.86	0.8890	SHMT3
AT2G14045			unknown protein		Potri.019G014100 [exp]	13.41	0.8829
AT5G55970			RING/U-box superfamily protein...		Potri.001G371200 [exp]	14.69	0.8847
AT4G33450	MYB	ATMYB69	myb domain protein 69 (.1)		Potri.007G106100 [exp]	16.61	0.8692
AT4G27270			Quinone reductase family prote...		Potri.004G028900 [exp]	16.88	0.8829
AT1G01630			Sec14p-like phosphatidylinosit...		Potri.003G162100 [exp]	17.14	0.8575
AT4G13940		MEE58, EMB1395,...	MATERNAL EFFECT EMBRYO ARREST ...		Potri.017G059400 [exp]	19.59	0.8779	Pt-SAHH.2
AT5G17920		ATCIMS, ATMETS,...	methionine synthesis 1, COBALA...		Potri.009G152800 [exp]	20.71	0.8705
AT4G13940		MEE58, EMB1395,...	MATERNAL EFFECT EMBRYO ARREST ...		Potri.001G320500 [exp]	20.83	0.8773	SAHH.1

Compare expression of checked genes

Potri.001G009100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.