Plant FIBer expression Database

Potri.001G009501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20480 68 / 4e-17 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032280
[exp]
62 / 8e-13 AT4G11410 461 / 5e-163 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10024646
[exp]
36 / 0.0003 AT4G11410 82 / 6e-20 NAD(P)-binding Rossmann-fold superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.001G009501.1 pacid=42793545 polypeptide=Potri.001G009501.1.p locus=Potri.001G009501 ID=Potri.001G009501.1.v4.1 annot-version=v4.1
ATGGAAGGGCCAGAGATGTCTTCATCAACACCAACAGCAACGATCAAGACCAGCAATAACAATGATTTTAAGCCACAAAAACCACTGTTCAGGCCAGCTC
AAGATGACACCAAGCCTCCACTCAAAGACCCAATTCTGAGATCAGACCCAATTGAGACTGAAGAAGCAGTGCTAAAGCTGCCTCCTTTCCCATTTTGCAA
ATCAAAATGA
AA sequence
>Potri.001G009501.1 pacid=42793545 polypeptide=Potri.001G009501.1.p locus=Potri.001G009501 ID=Potri.001G009501.1.v4.1 annot-version=v4.1
MEGPEMSSSTPTATIKTSNNNDFKPQKPLFRPAQDDTKPPLKDPILRSDPIETEEAVLKLPPFPFCKSK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G20480 unknown protein Potri.001G009501
[exp]
0 1
AT4G26840 ATSUMO1, SUMO1,... ARABIDOPSIS THALIANA SMALL UBI... Potri.002G224700
[exp]
1.41 0.8466 Pt-SUM1.1
AT1G02280 PPI1, ATTOC33, ... PLASTID PROTEIN IMPORT 1, tran... Potri.002G183400
[exp]
1.41 0.8411 Pt-PPI1.3
AT5G58005 Cytochrome c oxidase, subunit ... Potri.006G186500
[exp]
3.16 0.7470
AT2G29690 ATHANSYNAB, ASA... anthranilate synthase 2 (.1) Potri.001G250300
[exp]
4.00 0.7341
AT1G12300 Tetratricopeptide repeat (TPR)... Potri.017G133501
[exp]
9.05 0.6881
AT1G02780 EMB2386 embryo defective 2386, Ribosom... Potri.004G078000
[exp]
10.39 0.7528 Pt-RPL19.3
AT1G12020 unknown protein Potri.011G022900
[exp]
10.58 0.6777
Potri.003G178500
[exp]
10.95 0.7799
AT5G20510 Alfin AL5 alfin-like 5 (.1) Potri.006G223500
[exp]
14.45 0.7232
AT3G14470 NB-ARC domain-containing disea... Potri.003G201900
[exp]
16.12 0.7183

Potri.001G009501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.