Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60900 166 / 8e-49 RLK1 receptor-like protein kinase 1 (.1) AT1G34300 112 / 2e-29 lectin protein kinase family protein (.1) AT5G24080 96 / 7e-24 Protein kinase superfamily protein (.1) AT4G32300 96 / 7e-24 SD2-5 S-domain-2 5 (.1) AT2G19130 92 / 2e-22 S-locus lectin protein kinase family protein (.1) AT1G60800 88 / 4e-21 NIK3 NSP-interacting kinase 3 (.1) AT4G00340 87 / 1e-20 RLK4 receptor-like protein kinase 4 (.1) AT5G39000 86 / 2e-20 Malectin/receptor-like protein kinase family protein (.1) AT1G53430 84 / 1e-19 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G11050 84 / 1e-19 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T084351 [exp] 189 / 1e-59 AT5G60900 419 / 4e-141 receptor-like protein kinase 1 (.1) Potri.001G014600 [exp] 195 / 3e-59 AT5G60900 666 / 0.0 receptor-like protein kinase 1 (.1) Potri.001G014100 [exp] 194 / 5e-59 AT5G60900 669 / 0.0 receptor-like protein kinase 1 (.1) Potri.001G228200 [exp] 191 / 1e-57 AT5G60900 601 / 0.0 receptor-like protein kinase 1 (.1) Potri.003G211932 [exp] 186 / 1e-57 AT5G60900 510 / 7e-175 receptor-like protein kinase 1 (.1) Potri.T084200 [exp] 189 / 2e-57 AT5G60900 573 / 0.0 receptor-like protein kinase 1 (.1) Potri.T084300 [exp] 183 / 5e-55 AT5G60900 645 / 0.0 receptor-like protein kinase 1 (.1) Potri.T084401 [exp] 183 / 5e-55 AT5G60900 641 / 0.0 receptor-like protein kinase 1 (.1) Potri.T084500 [exp] 177 / 1e-52 AT5G60900 653 / 0.0 receptor-like protein kinase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031804 [exp] 171 / 1e-53 AT5G60900 234 / 2e-71 receptor-like protein kinase 1 (.1) Lus10031805 [exp] 169 / 1e-49 AT5G60900 530 / 5e-178 receptor-like protein kinase 1 (.1) Lus10031231 [exp] 168 / 3e-49 AT5G60900 536 / 2e-180 receptor-like protein kinase 1 (.1) Lus10024195 [exp] 166 / 2e-48 AT5G60900 367 / 3e-114 receptor-like protein kinase 1 (.1) Lus10018251 [exp] 154 / 3e-48 AT5G60900 213 / 2e-65 receptor-like protein kinase 1 (.1) Lus10031230 [exp] 162 / 3e-47 AT5G60900 388 / 4e-123 receptor-like protein kinase 1 (.1) Lus10030400 [exp] 156 / 2e-46 AT5G60900 356 / 1e-115 receptor-like protein kinase 1 (.1) Lus10004365 [exp] 146 / 1e-41 AT5G60900 545 / 0.0 receptor-like protein kinase 1 (.1) Lus10010992 [exp] 136 / 6e-38 AT5G60900 540 / 0.0 receptor-like protein kinase 1 (.1) Lus10042940 [exp] 134 / 4e-37 AT5G60900 381 / 1e-120 receptor-like protein kinase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Potri.001G014501.1 pacid=42788055 polypeptide=Potri.001G014501.1.p locus=Potri.001G014501 ID=Potri.001G014501.1.v4.1 annot-version=v4.1 ATGGGGAGCCGGAATCCCCAACATAAAGGAACTAAAGGGTATGTGGCACCAGAATGGTTTAGGAACATGCTGATCACAGTGAAGGTGGATGTGTACAATT TTGGTGTCTTGTTGTTGGAGATTATCTGTTGTCGAAGAAGTGTAGATACAGAAGTAGGAGAGGAGAGAGCAATTCTAACAGACTGGGCTTATGATTGCTA TCAAGAAGGCATGATGCATGCTTTGGTTGAAAGCGATGAGGAGGCCTTGAATGATATGAAGAAGCTCGAGAGGTTTGTGATGGTTGCAATTTGGTGCATT CAGGAAGACCCCAACCTGAGACCAACCATGAAGATGGTTATGCTGATGCTCGAAGGCATAATTCAAGTTCCTGTTCCACCATGTCCAAGCCCATTTAGTA TAGCTAGTTGA
AA sequence Show only first row Show all	>Potri.001G014501.1 pacid=42788055 polypeptide=Potri.001G014501.1.p locus=Potri.001G014501 ID=Potri.001G014501.1.v4.1 annot-version=v4.1 MGSRNPQHKGTKGYVAPEWFRNMLITVKVDVYNFGVLLLEIICCRRSVDTEVGEERAILTDWAYDCYQEGMMHALVESDEEALNDMKKLERFVMVAIWCI QEDPNLRPTMKMVMLMLEGIIQVPVPPCPSPFSIAS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.001G014501 [exp]	0	1
AT4G10780			LRR and NB-ARC domains-contain...		Potri.017G035300 [exp]	6.55	0.9026
AT4G27300			S-locus lectin protein kinase ...		Potri.011G126251 [exp]	7.74	0.8863
AT4G25550			Cleavage/polyadenylation speci...		Potri.012G140301 [exp]	9.00	0.8825
AT3G12060		TBL1	TRICHOME BIREFRINGENCE-LIKE 1,...		Potri.019G090000 [exp]	16.79	0.8053
AT5G03860		MLS	malate synthase (.1.2)		Potri.012G094532 [exp]	22.00	0.8518
AT3G52600		ATCWINV2	cell wall invertase 2 (.1.2)		Potri.016G077400 [exp]	24.00	0.8563
AT3G50160			Plant protein of unknown funct...		Potri.016G039100 [exp]	28.74	0.8717
AT1G61310			LRR and NB-ARC domains-contain...		Potri.001G444600 [exp]	34.29	0.8503
AT1G27170			transmembrane receptors;ATP bi...		Potri.011G012801 [exp]	36.66	0.8621
AT5G21930		ATHMA8, HMA8, P...	ARABIDOPSIS HEAVY METAL ATPASE...		Potri.006G220301 [exp]	40.12	0.8592

Compare expression of checked genes

Potri.001G014501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.