Potri.001G016100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G24225 38 / 8e-05 ESR19, CLE19, ATCLE19 EMBRYO SURROUNDING REGION 19, CLAVATA3/ESR-RELATED 19 (.1)
AT2G27250 35 / 0.0008 AtCLV3, CLV3 CLAVATA3 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001854 39 / 8e-05 ND 40 / 3e-05
Lus10031246 38 / 0.0003 ND 35 / 0.004
PFAM info
Representative CDS sequence
>Potri.001G016100.2 pacid=42793396 polypeptide=Potri.001G016100.2.p locus=Potri.001G016100 ID=Potri.001G016100.2.v4.1 annot-version=v4.1
ATGGCATTTGGAGATGGTCTCTCAAGGTTTTCATCAATCTCCATTGCTTTGATCATCTTGACCTTTGTTTTGATGCCATTAGTCCATTCCTCTCGTTCCT
TAGCAGCAGGAAATAGAGCCAGAGCTTCAGCACAGGATATTCATCAAAGTTATAAGATCACAAGAATGGGGAAGGGAGCATCAAGTTTAGTCACAGATGA
GGAGTCAGAGAGAGAAGTACCAACTGGACCAGACCCTCTTCACCACAACAACAACCCAACTACAAGACCATGA
AA sequence
>Potri.001G016100.2 pacid=42793396 polypeptide=Potri.001G016100.2.p locus=Potri.001G016100 ID=Potri.001G016100.2.v4.1 annot-version=v4.1
MAFGDGLSRFSSISIALIILTFVLMPLVHSSRSLAAGNRARASAQDIHQSYKITRMGKGASSLVTDEESEREVPTGPDPLHHNNNPTTRP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G24225 ESR19, CLE19, A... EMBRYO SURROUNDING REGION 19, ... Potri.001G016100 0 1
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Potri.012G112800 1.41 0.9423
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Potri.012G113433 12.40 0.8226
Potri.001G386550 15.55 0.8226
Potri.018G119450 15.55 0.8142
AT1G43760 DNAse I-like superfamily prote... Potri.010G033133 19.07 0.8019
AT3G16360 AHP4 HPT phosphotransmitter 4 (.1.2... Potri.001G464900 22.49 0.8133
Potri.012G116401 24.39 0.6650
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Potri.012G114266 24.97 0.8092
AT1G28640 GDSL-like Lipase/Acylhydrolase... Potri.004G225100 27.45 0.7375
Potri.007G065950 28.98 0.6525

Potri.001G016100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.