Potri.001G016900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
AT5G10400 235 / 3e-81 Histone superfamily protein (.1)
AT5G10390 235 / 3e-81 Histone superfamily protein (.1)
AT3G27360 235 / 3e-81 Histone superfamily protein (.1)
AT1G09200 235 / 3e-81 Histone superfamily protein (.1)
AT4G40040 232 / 6e-80 Histone superfamily protein (.1.2)
AT4G40030 232 / 6e-80 Histone superfamily protein (.1.2.3)
AT5G10980 232 / 6e-80 Histone superfamily protein (.1)
AT5G65350 224 / 6e-77 HTR11 histone 3 11 (.1)
AT1G75600 223 / 1e-76 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G233900 235 / 3e-81 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Potri.014G096900 235 / 3e-81 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.002G028800 235 / 3e-81 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G210100 235 / 3e-81 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207852 235 / 3e-81 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207700 235 / 3e-81 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.001G016700 235 / 3e-81 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.007G096700 232 / 6e-80 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Potri.007G014300 232 / 6e-80 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031822 235 / 3e-81 AT5G10400 271 / 1e-95 Histone superfamily protein (.1)
Lus10005271 235 / 3e-81 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10005270 235 / 3e-81 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10031250 235 / 3e-81 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10025439 235 / 3e-81 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Lus10012744 234 / 6e-81 AT5G65360 271 / 2e-95 Histone superfamily protein (.1)
Lus10031821 236 / 8e-81 AT3G27360 273 / 3e-95 Histone superfamily protein (.1)
Lus10013948 235 / 4e-80 AT3G27360 272 / 7e-95 Histone superfamily protein (.1)
Lus10031252 232 / 4e-80 AT3G27360 268 / 2e-94 Histone superfamily protein (.1)
Lus10012757 187 / 1e-62 AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Potri.001G016900.1 pacid=42792176 polypeptide=Potri.001G016900.1.p locus=Potri.001G016900 ID=Potri.001G016900.1.v4.1 annot-version=v4.1
ATGGCCCGCACAAAGCAGACAGCAAGAAAATCGACCGGAGGGAAGGCCCCAAGGAAGCAACTAGCGACCAAGGCTGCCAGGAAGTCAGCTCCAGCCACCG
GAGGAGTGAAGAAGCCCCACCGATTCAGGCCGGGAACGGTGGCCTTGAGAGAAATAAGGAAGTACCAGAAGAGCACAGAGCTGTTGATAAGAAAGCTACC
ATTTCAGAGGCTGGTGAGAGAAATAGCCCAAGATTTCAAGACAGACTTGAGGTTCCAAAGCAGCGCAGTAGCAGCACTTCAAGAGGCAGCAGAGGCATAC
CTTGTTGGGTTGTTTGAGGACACCAACTTGTGTGCTATTCATGCTAAGAGGGTCACTATCATGCCTAAGGATATTCAACTGGCCCGTAGAATTAGAGGGG
AGAGAGCTTAA
AA sequence
>Potri.001G016900.1 pacid=42792176 polypeptide=Potri.001G016900.1.p locus=Potri.001G016900 ID=Potri.001G016900.1.v4.1 annot-version=v4.1
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G65360 Histone superfamily protein (.... Potri.001G016900 0 1
AT3G25100 CDC45 cell division cycle 45 (.1) Potri.015G090600 2.44 0.8887
AT1G14900 HMGA high mobility group A (.1) Potri.010G109600 3.31 0.8744
AT5G65360 Histone superfamily protein (.... Potri.014G096900 3.31 0.9160 HTR906
AT5G65360 Histone superfamily protein (.... Potri.002G028800 4.47 0.9115
AT1G08880 HTA5 ,G-H2AX ,G... histone H2A 5, gamma histone v... Potri.013G028800 5.19 0.9084
AT5G65360 Histone superfamily protein (.... Potri.005G233900 5.29 0.9040
AT1G08880 HTA5 ,G-H2AX ,G... histone H2A 5, gamma histone v... Potri.005G040700 5.29 0.8850
AT5G27670 HTA7 histone H2A 7 (.1) Potri.013G018200 7.07 0.9030
AT1G48405 Kinase interacting (KIP1-like)... Potri.012G038000 7.74 0.8789
AT1G07790 HTB1 Histone superfamily protein (.... Potri.010G230600 9.79 0.8826 HISH2.2,HTB901

Potri.001G016900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.