Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07740 218 / 5e-70 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G28010 108 / 1e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G09900 105 / 5e-27 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G46100 104 / 9e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63130 104 / 2e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G12775 103 / 4e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G16640 102 / 5e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G04760 102 / 6e-26 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G64583 102 / 9e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62930 102 / 1e-25 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G204100 [exp] 278 / 3e-93 AT1G07740 502 / 2e-176 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G034200 [exp] 111 / 4e-29 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046200 [exp] 111 / 5e-29 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.007G123600 [exp] 111 / 6e-29 AT1G06710 1248 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G034300 [exp] 110 / 7e-29 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G050500 [exp] 110 / 1e-28 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G045000 [exp] 110 / 1e-28 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G257300 [exp] 110 / 2e-28 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G103600 [exp] 108 / 3e-28 AT5G18475 546 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040869 [exp] 220 / 1e-70 AT1G07740 491 / 5e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10005876 [exp] 167 / 4e-53 AT1G07740 256 / 5e-84 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10026545 [exp] 108 / 7e-28 AT2G17140 1002 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013832 [exp] 107 / 2e-27 AT2G17140 1034 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013283 [exp] 106 / 3e-27 AT1G05670 785 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) Lus10003433 [exp] 103 / 5e-26 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10006373 [exp] 102 / 8e-26 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012328 [exp] 102 / 8e-26 AT3G53700 1010 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012139 [exp] 102 / 1e-25 AT5G59900 987 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10022861 [exp] 102 / 1e-25 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF12854 [poplar] [flax] PPR_1 PPR repeat CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.001G020501.1 pacid=42791331 polypeptide=Potri.001G020501.1.p locus=Potri.001G020501 ID=Potri.001G020501.1.v4.1 annot-version=v4.1 ATGATCAGAGGGCAGTTTGAGAAGGGTGAGTGGAAGCAAGCTTGCAAGGTGTTTGAAGAAATGCTTGAGACGAAAGTGGAACCCAGTGTTGCGACGTTTA ATAGTCTTATTGGGTATTTGTGTGGAAATGGGGAGTTGGATAAGGCATTGTTAGAGGATATGATTAAGAGAGGGAAACGTCCAAATGCGGTAACATATGC TTTGTTAATGGAAGGCTTGTGCTTGATAGGCGAGCATGATGAGGCTAAAAAGATGATGTTTGATATGGAATACAGAGGGTGTAAACCTGCAGTTGTGAAT TTTGGTGTTTTGATGTCCGATCTTGTGAAGGGAGGGAAGATTGAGGAAGCAAAATCTTTGGTTCATGAAATGAAGAAGAGGCATTTAAAGAAGGATGTTG TTACTTACAATATATTGATCAATTATCTTTGCAAGGAGGGCAGGGCAGCAGAGGCCTATAAAGTTTTGTTTGAAATGCAAGTTATGTAA
AA sequence Show only first row Show all	>Potri.001G020501.1 pacid=42791331 polypeptide=Potri.001G020501.1.p locus=Potri.001G020501 ID=Potri.001G020501.1.v4.1 annot-version=v4.1 MIRGQFEKGEWKQACKVFEEMLETKVEPSVATFNSLIGYLCGNGELDKALLEDMIKRGKRPNAVTYALLMEGLCLIGEHDEAKKMMFDMEYRGCKPAVVN FGVLMSDLVKGGKIEEAKSLVHEMKKRHLKKDVVTYNILINYLCKEGRAAEAYKVLFEMQVM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G07740			Tetratricopeptide repeat (TPR)...		Potri.001G020501 [exp]	0	1
AT1G34160			Tetratricopeptide repeat (TPR)...		Potri.005G199800 [exp]	1.00	0.9295
AT5G52380			VASCULAR-RELATED NAC-DOMAIN 6 ...		Potri.012G141700 [exp]	2.44	0.8838
AT5G21970			Ubiquitin carboxyl-terminal hy...		Potri.006G218100 [exp]	3.46	0.9006
AT4G39470			Tetratricopeptide repeat (TPR)...		Potri.005G085700 [exp]	4.00	0.8801
AT5G61190	C2H2ZnF		putative endonuclease or glyco...		Potri.017G091700 [exp]	4.89	0.8607
AT1G26660			Prefoldin chaperone subunit fa...		Potri.008G091400 [exp]	6.32	0.8691
AT3G22690			unknown protein		Potri.010G083700 [exp]	6.48	0.8832
AT1G01940			Cyclophilin-like peptidyl-prol...		Potri.014G071600 [exp]	10.72	0.8336
AT1G50910			unknown protein		Potri.011G136400 [exp]	12.40	0.8686
AT1G52640			Pentatricopeptide repeat (PPR)...		Potri.004G102700 [exp]	12.72	0.8992

Compare expression of checked genes

Potri.001G020501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.