Plant FIBer expression Database

Potri.001G022500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G31560 68 / 3e-15 HCF153 high chlorophyll fluorescence 153 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G203300
[exp]
67 / 2e-15 AT4G31560 / high chlorophyll fluorescence 153 (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G022500.2 pacid=42792502 polypeptide=Potri.001G022500.2.p locus=Potri.001G022500 ID=Potri.001G022500.2.v4.1 annot-version=v4.1
ATGGCCAGTATCCCAATCCCCTTCTCTCCTCTCTCAACCACACCCCCACGTGCCTTCTTTAAGCCTCTTCACCTGCCAACCTCACCGGCGATTCGTATCT
CCGATGACCCTTGGAGGAGGAAGAAGAGAGGTTTGACAGTGGTGACACGTGCAGGGCTCAGCGCCAACAGCTACGTGCTGGCATTCCTGCTCCCTCTTTC
TCTCCTTGCTGCCACTATCTTTACTTCTATTAGAATTGCTGATAAGCTTGATCAAGACTATCTTGAGGAGCTTGAAATCATTCAAGCAATCAAGGAAGCA
GATGAAGAGGATGATGACAGTGACGATGGCGAGGACTATGAGAATGCAGATGACAATATTGTTGACATTTCTTTAGAGGAGGAATTGCAGCCTGTGCTTC
AACGTACACGAACTCGCAACCGGCCTAAGCGGGAAGCCTAG
AA sequence
>Potri.001G022500.2 pacid=42792502 polypeptide=Potri.001G022500.2.p locus=Potri.001G022500 ID=Potri.001G022500.2.v4.1 annot-version=v4.1
MASIPIPFSPLSTTPPRAFFKPLHLPTSPAIRISDDPWRRKKRGLTVVTRAGLSANSYVLAFLLPLSLLAATIFTSIRIADKLDQDYLEELEIIQAIKEA
DEEDDDSDDGEDYENADDNIVDISLEEELQPVLQRTRTRNRPKREA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G31560 HCF153 high chlorophyll fluorescence ... Potri.001G022500
[exp]
0 1
AT2G36145 unknown protein Potri.006G210000
[exp]
6.24 0.9684
AT5G10910 mraW methylase family protein ... Potri.005G179700
[exp]
8.54 0.9363
AT1G67740 YCF32, PSBY photosystem II BY (.1) Potri.010G052000
[exp]
9.32 0.9676 PSBY.2
AT3G61870 unknown protein Potri.014G102400
[exp]
9.59 0.9678
AT4G24700 unknown protein Potri.015G084200
[exp]
10.19 0.9670
AT1G67280 Glyoxalase/Bleomycin resistanc... Potri.018G042100
[exp]
11.83 0.9581
AT1G76080 ATCDSP32, CDSP3... ARABIDOPSIS THALIANA CHLOROPLA... Potri.002G016401
[exp]
12.68 0.9627
AT1G54780 AtTLP18.3, TLP1... thylakoid lumen protein 18.3, ... Potri.013G026400
[exp]
13.03 0.9658
AT3G54210 Ribosomal protein L17 family p... Potri.016G143100
[exp]
14.49 0.9644
AT3G26630 Tetratricopeptide repeat (TPR)... Potri.002G220600
[exp]
14.83 0.9612

Potri.001G022500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.