Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49040 167 / 6e-53 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G55210 162 / 3e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT5G42500 162 / 4e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 162 / 5e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 162 / 6e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT2G21100 155 / 4e-48 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G22900 155 / 5e-48 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G58170 151 / 1e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13660 141 / 2e-43 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G061000 [exp] 199 / 3e-65 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G023600 [exp] 192 / 1e-62 AT5G49040 146 / 1e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 191 / 1e-62 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.006G195300 [exp] 187 / 1e-60 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060900 [exp] 182 / 1e-58 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 179 / 2e-57 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216400 [exp] 177 / 2e-56 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216200 [exp] 174 / 8e-56 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.001G009100 [exp] 174 / 2e-55 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039561 [exp] 229 / 2e-77 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10029306 [exp] 184 / 1e-59 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10026176 [exp] 173 / 5e-55 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10042488 [exp] 172 / 1e-54 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 171 / 1e-54 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034476 [exp] 166 / 4e-52 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034479 [exp] 163 / 2e-51 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034478 [exp] 164 / 4e-51 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025064 [exp] 162 / 6e-51 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025063 [exp] 163 / 1e-50 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [poplar] [flax] AOC_barrel PF03018 [poplar] [flax] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Potri.001G023800.1 pacid=42789003 polypeptide=Potri.001G023800.1.p locus=Potri.001G023800 ID=Potri.001G023800.1.v4.1 annot-version=v4.1 ATGGCTTCTCATGTGGCTTGCACTCTCTTCACCCTTCACTTCATCCTATTATCATACTTGTGCACAATCACATGTGGGGCTTTCTATGAGGAAGTAACTG AAGCCATAGCTATCAAGCGCATAGAAAAGACCACACACCTACATTTCTACTTCCACGACATTGTTAGTGGAAAACATCCAACAGCTATTAGAATTGCCGG CCCGGATAATTATGCCTTTGGTGACACAATGATGGCGGATGATCCGTTGACGGAAGGGCTTGAAATTTCTTCAAAGCCTGTTGGAAAAGCTCAAGGACTC TATGCCTTAGCCTCGCAAAACGATTTTTGTTTGCTAATGGTTATGAATTTTGCTTTTACAGAAGGTAAATATAATGGAAGTAGTATTAGCATCCTTGGAA GGAACCAAATCCTGAATGATGTGAGGGAAATGCCAATCGTTGGAGGTAGTGGGCTATTTAGGCTTGCTCATGGCTACGCATTGGCACATACAGTTTGGTT TGACGAGCAAGGTGATGCTACTGTCGAATATAATGTGTATGTGTCACACTACTGA
AA sequence Show only first row Show all	>Potri.001G023800.1 pacid=42789003 polypeptide=Potri.001G023800.1.p locus=Potri.001G023800 ID=Potri.001G023800.1.v4.1 annot-version=v4.1 MASHVACTLFTLHFILLSYLCTITCGAFYEEVTEAIAIKRIEKTTHLHFYFHDIVSGKHPTAIRIAGPDNYAFGDTMMADDPLTEGLEISSKPVGKAQGL YALASQNDFCLLMVMNFAFTEGKYNGSSISILGRNQILNDVREMPIVGGSGLFRLAHGYALAHTVWFDEQGDATVEYNVYVSHY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G13650			Disease resistance-responsive ...		Potri.001G023800 [exp]	0	1
AT4G00430		PIP1;4, TMP-C, ...	TRANSMEMBRANE PROTEIN C, PLASM...		Potri.016G113300 [exp]	2.23	0.8353
AT4G18425			Protein of unknown function (D...		Potri.011G058000 [exp]	3.16	0.8508
AT5G61750			RmlC-like cupins superfamily p...		Potri.012G111500 [exp]	3.60	0.8557
AT1G11190		ENDO1, BFN1	ENDONUCLEASE 1, bifunctional n...		Potri.011G044500 [exp]	4.89	0.8473	BFN1.1
					Potri.019G038310 [exp]	9.38	0.8375
AT1G26820		RNS3	ribonuclease 3 (.1)		Potri.008G086800 [exp]	10.58	0.8117	S.4
AT2G45420	AS2	LBD18, ASL20	LOB domain-containing protein ...		Potri.014G070400 [exp]	10.90	0.7864	LBD18.1
					Potri.015G010500 [exp]	12.68	0.6646
AT3G21550		AtDMP2	Arabidopsis thaliana DUF679 do...		Potri.008G115100 [exp]	13.41	0.8083
AT3G49070			Protein of unknown function (D...		Potri.015G147400 [exp]	14.45	0.8041

Compare expression of checked genes

Potri.001G023800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.