Potri.001G024000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15750 137 / 8e-41 Essential protein Yae1, N-terminal (.1)
AT1G34570 135 / 6e-40 Essential protein Yae1, N-terminal (.1)
AT1G34550 57 / 2e-09 EMB2756 EMBRYO DEFECTIVE 2756, Protein of unknown function (DUF616) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G201500 305 / 2e-106 AT3G15750 141 / 5e-42 Essential protein Yae1, N-terminal (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019775 175 / 1e-54 AT1G34570 130 / 3e-37 Essential protein Yae1, N-terminal (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0255 ATP_synthase PF09811 Yae1_N Essential protein Yae1, N terminal
Representative CDS sequence
>Potri.001G024000.1 pacid=42788387 polypeptide=Potri.001G024000.1.p locus=Potri.001G024000 ID=Potri.001G024000.1.v4.1 annot-version=v4.1
ATGGAAGGTAGTATTGCTAAGGAGCTTTACTCAGAAAGCTTGCAACTTTCAAGTGCTGAATTGGGTTCTGAGCCAATTGCCTTTGGTGACTTGCAAGATG
ATGGGTCTTTATGGGATGTTTCTGATGAGGAGTTGGATAGAGATTCTGATTTGGACCGGGAGTGGCAAAGGAGACATGATCAATTTCACACTATTGGATA
TCGCGATGGCCTCATATCAGGAAAAGAAGCTTCTGCGCAAGAGGGATTCAATAATGGTTTTAAACAATCAGTGCTTGCAGGATACAACTGGGGTGTTGCT
AGAGGTGTTACAAGCGCGCTTGCCTGCCTTCCAGATGCATTGAAGGAGAGGCTGATTGAAGATCAAGAAAAAAGAAACAAATTCCAGGGCGTTTATGAAA
CAGTGCATTCTGTTTCAACAACAGATGCTCTTAAGTTCTTTCATGATGATGTATTGAGAAAGAAAGAAGAGGAGCAAAGTGAGCATTCCAAGGCTAGTTC
TAATGTATCTGGAATGAGTAAAGATAGCTCAGGCTGCAGTCATCTCGAAAATTATGTTGGGGAGCTTCAATCACTCCTTCTTGAGTCTCCTGCTATCAAG
TCACATTTATCAGTAAAGTAA
AA sequence
>Potri.001G024000.1 pacid=42788387 polypeptide=Potri.001G024000.1.p locus=Potri.001G024000 ID=Potri.001G024000.1.v4.1 annot-version=v4.1
MEGSIAKELYSESLQLSSAELGSEPIAFGDLQDDGSLWDVSDEELDRDSDLDREWQRRHDQFHTIGYRDGLISGKEASAQEGFNNGFKQSVLAGYNWGVA
RGVTSALACLPDALKERLIEDQEKRNKFQGVYETVHSVSTTDALKFFHDDVLRKKEEEQSEHSKASSNVSGMSKDSSGCSHLENYVGELQSLLLESPAIK
SHLSVK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G15750 Essential protein Yae1, N-term... Potri.001G024000 0 1
AT3G21865 PEX22 peroxin 22 (.1) Potri.017G038800 2.44 0.8501
AT3G44680 HDA09, HDA9 histone deacetylase 9 (.1) Potri.001G460000 3.16 0.8528 Pt-HDA9.2,HDA904
AT2G45130 ATSPX3 ARABIDOPSIS THALIANA SPX DOMAI... Potri.014G061400 3.46 0.8568
AT5G10980 Histone superfamily protein (.... Potri.005G072300 3.74 0.8499
AT1G52343 unknown protein Potri.003G055200 4.89 0.8594
Potri.006G029500 6.63 0.8703
AT1G26665 Mediator complex, subunit Med1... Potri.003G146900 6.70 0.8470
AT5G47540 Mo25 family protein (.1) Potri.006G014800 7.34 0.8128
AT1G29800 RING/FYVE/PHD-type zinc finger... Potri.011G106700 8.00 0.8540
AT4G11980 ATNUDX14, ATNUD... ARABIDOPSIS THALIANA NUDIX HYD... Potri.003G118300 10.95 0.8478

Potri.001G024000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.