Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61790 450 / 1e-160 Protein with RING/U-box and TRAF-like domains (.1) AT4G27880 446 / 3e-159 Protein with RING/U-box and TRAF-like domains (.1) AT3G58040 435 / 7e-155 SINAT2 seven in absentia of Arabidopsis 2 (.1) AT2G41980 430 / 6e-153 Protein with RING/U-box and TRAF-like domains (.1) AT5G53360 364 / 3e-128 TRAF-like superfamily protein (.1) AT3G13672 220 / 1e-71 TRAF-like superfamily protein (.1.2) AT5G37870 99 / 3e-24 Protein with RING/U-box and TRAF-like domains (.1) AT5G37910 94 / 2e-22 Protein with RING/U-box and TRAF-like domains (.1) AT5G37890 91 / 6e-21 Protein with RING/U-box and TRAF-like domains (.1) AT5G62800 91 / 7e-21 Protein with RING/U-box and TRAF-like domains (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G198600 [exp] 571 / 0 AT3G61790 473 / 2e-169 Protein with RING/U-box and TRAF-like domains (.1) Potri.T126006 [exp] 571 / 0 AT3G61790 473 / 2e-169 Protein with RING/U-box and TRAF-like domains (.1) Potri.014G099200 [exp] 452 / 3e-161 AT3G61790 551 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Potri.002G171500 [exp] 451 / 5e-161 AT3G61790 558 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Potri.016G059700 [exp] 449 / 2e-160 AT3G58040 548 / 0.0 seven in absentia of Arabidopsis 2 (.1) Potri.012G015500 [exp] 449 / 6e-160 AT4G27880 542 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Potri.006G194100 [exp] 446 / 2e-159 AT3G58040 560 / 0.0 seven in absentia of Arabidopsis 2 (.1) Potri.015G013000 [exp] 444 / 2e-158 AT4G27880 546 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Potri.003G215400 [exp] 417 / 6e-148 AT3G58040 471 / 4e-169 seven in absentia of Arabidopsis 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002761 [exp] 531 / 0 AT3G61790 462 / 1e-164 Protein with RING/U-box and TRAF-like domains (.1) Lus10016348 [exp] 526 / 0 AT3G61790 459 / 7e-163 Protein with RING/U-box and TRAF-like domains (.1) Lus10022405 [exp] 446 / 1e-158 AT4G27880 553 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Lus10018110 [exp] 446 / 1e-158 AT4G27880 553 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Lus10004001 [exp] 440 / 1e-156 AT3G61790 525 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Lus10030248 [exp] 433 / 1e-153 AT3G61790 514 / 0.0 Protein with RING/U-box and TRAF-like domains (.1) Lus10013739 [exp] 427 / 1e-151 AT3G58040 493 / 6e-178 seven in absentia of Arabidopsis 2 (.1) Lus10039202 [exp] 424 / 1e-150 AT3G58040 488 / 1e-175 seven in absentia of Arabidopsis 2 (.1) Lus10009111 [exp] 56 / 6e-09 AT5G37930 134 / 5e-38 Protein with RING/U-box and TRAF-like domains (.1) Lus10028535 [exp] 55 / 9e-09 AT5G37930 134 / 7e-38 Protein with RING/U-box and TRAF-like domains (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0389 [poplar] [flax] TRAF PF03145 [poplar] [flax] Sina Seven in absentia protein family
Representative CDS sequence Show only first row Show all	>Potri.001G026200.1 pacid=42792359 polypeptide=Potri.001G026200.1.p locus=Potri.001G026200 ID=Potri.001G026200.1.v4.1 annot-version=v4.1 ATGACAATCCGAAATAAGCCTGAGGTTATTGATCCTCCTCAAAATAAAGACATGACAGATATCGTTGAATGTGTAAACAGTCCTGCTAAGACAGCTTTAA AACCAAATGTGACTGTGTCTAGCAGTGTTCACGAATTATTGGAGTGTCCCGTGTGCTTAAATGCCATGTATCCTCCAATTCATCAGTGTTCAAATGGTCA CACATTATGTTCCAGTTGCAAGCCCAGAGTTCATGGCCGATGCCCCATTTGCAGGCATGAACTTGGCAACATTAGATGTCTTGCGCTAGAGAAAGTTGCT GCATCTCTTGAACTTCCATGTATTTATCGGAGTTTTGGGTGCATAGGAATATACCCTTATCACAGCAAGTCAAAACATGAATCCCAATGTGTTTTTAGAC CGTATAGCTGCCCATATTCTGGATCAGAATGCACGGCTATTGGTGATATTCCTTATCTGGTGGCACATTTGAAAGATGATCACAAAGTTGACATGCATAA TGGCAGTACTTTCAACCACAGATATGTCAAATCAAATCCACATGAAGTTGAGAACGCAACATGGATGCTGACGGTTTTTAGCTGCTTTGGTCAGTATTTT TGTCTGCATTTTGAAGCATTCCACCTCGGGATGTCCCCAGTCTACATAGCATTCCTGAGGTTTATGGGCGATGACAATGAGGCAAAGAACCATAGTTACA GTCTTCAAGTATGTGGAAGTGGTAGGAAGATGACATGGCAAGGGGTGCCTAGGAGCATTAGGGATAGCCACCGGAAGGTTCGTGACAGCTTTGATGGTCT TGTTATCCAGCGCAACATGGCCCTTTTATTCTCTGGTGGAGATCGGAAGGAATTGAAGCTTCGGGTGACTGGTCGGATTTGGAAAGAACAGTGA
AA sequence Show only first row Show all	>Potri.001G026200.1 pacid=42792359 polypeptide=Potri.001G026200.1.p locus=Potri.001G026200 ID=Potri.001G026200.1.v4.1 annot-version=v4.1 MTIRNKPEVIDPPQNKDMTDIVECVNSPAKTALKPNVTVSSSVHELLECPVCLNAMYPPIHQCSNGHTLCSSCKPRVHGRCPICRHELGNIRCLALEKVA ASLELPCIYRSFGCIGIYPYHSKSKHESQCVFRPYSCPYSGSECTAIGDIPYLVAHLKDDHKVDMHNGSTFNHRYVKSNPHEVENATWMLTVFSCFGQYF CLHFEAFHLGMSPVYIAFLRFMGDDNEAKNHSYSLQVCGSGRKMTWQGVPRSIRDSHRKVRDSFDGLVIQRNMALLFSGGDRKELKLRVTGRIWKEQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G61790			Protein with RING/U-box and TR...		Potri.001G026200 [exp]	0	1
AT1G42990	bZIP	AtBZIP60	Bbasic region/leucine zipper m...		Potri.005G257900 [exp]	1.73	0.7659
					Potri.017G077100 [exp]	3.87	0.8251
AT4G33920			Protein phosphatase 2C family ...		Potri.001G297200 [exp]	4.47	0.8164
AT5G26030		FC1, FC-I, ATFC...	ferrochelatase 1 (.1.2)		Potri.006G232100 [exp]	4.89	0.7431
AT5G23360			GRAM domain-containing protein...		Potri.017G152900 [exp]	6.70	0.7409
AT5G24590	NAC	TIP, ANAC091	Arabidopsis NAC domain contain...		Potri.012G007500 [exp]	6.92	0.7608
AT3G03280			unknown protein		Potri.008G127200 [exp]	8.12	0.7504
AT5G22380	NAC	ANAC090	NAC domain containing protein ...		Potri.001G218800 [exp]	11.40	0.7581
AT2G04305			Magnesium transporter CorA-lik...		Potri.001G285300 [exp]	16.43	0.7405
AT3G03280			unknown protein		Potri.010G116000 [exp]	18.76	0.7289

Compare expression of checked genes

Potri.001G026200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.