Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41310 203 / 2e-66 ARR8, ATRR3 RESPONSE REGULATOR 8, response regulator 3 (.1) AT3G57040 203 / 3e-66 ATRR4, ARR9 RESPONSE REGULATOR 4, response regulator 9 (.1) AT1G59940 161 / 9e-50 ARR3 response regulator 3 (.1) AT1G10470 159 / 1e-48 IBC7, ATRR1, ARR4, MEE7 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) AT3G48100 153 / 3e-47 ATRR2, IBC6, ARR5 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) AT5G62920 151 / 2e-46 ARR6 response regulator 6 (.1) AT3G56380 148 / 1e-45 ARR17 response regulator 17 (.1) AT1G19050 149 / 3e-45 ARR7 response regulator 7 (.1) AT2G40670 146 / 8e-45 ARR16 response regulator 16 (.1.2) AT1G74890 145 / 6e-44 ARR15 response regulator 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T124806 [exp] 312 / 7e-110 AT2G41310 232 / 6e-78 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.003G197466 [exp] 309 / 1e-108 AT2G41310 232 / 5e-78 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.016G038000 [exp] 215 / 5e-71 AT2G41310 242 / 2e-81 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.006G041100 [exp] 214 / 2e-70 AT3G57040 273 / 4e-93 RESPONSE REGULATOR 4, response regulator 9 (.1) Potri.002G082200 [exp] 169 / 8e-53 AT3G57040 180 / 1e-56 RESPONSE REGULATOR 4, response regulator 9 (.1) Potri.008G193000 [exp] 158 / 3e-48 AT1G59940 198 / 1e-63 response regulator 3 (.1) Potri.015G070000 [exp] 157 / 3e-48 AT3G48100 231 / 1e-77 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Potri.019G058900 [exp] 154 / 8e-48 AT3G56380 223 / 5e-76 response regulator 17 (.1) Potri.010G037800 [exp] 154 / 8e-47 AT1G59940 202 / 5e-65 response regulator 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039524 [exp] 218 / 2e-72 AT3G57040 222 / 2e-73 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10016334 [exp] 206 / 3e-67 AT3G57040 211 / 5e-69 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10002750 [exp] 204 / 3e-66 AT3G57040 212 / 4e-69 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10042153 [exp] 157 / 2e-48 AT3G48100 213 / 1e-70 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Lus10004243 [exp] 157 / 3e-48 AT3G48100 220 / 2e-73 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Lus10029211 [exp] 152 / 1e-45 AT1G10470 211 / 4e-68 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) Lus10030664 [exp] 150 / 1e-44 AT1G10470 206 / 2e-65 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) Lus10030822 [exp] 149 / 3e-44 AT1G59940 201 / 2e-64 response regulator 3 (.1) Lus10030359 [exp] 120 / 8e-34 AT2G41310 142 / 3e-42 RESPONSE REGULATOR 8, response regulator 3 (.1) Lus10007885 [exp] 118 / 4e-33 AT2G41310 143 / 1e-42 RESPONSE REGULATOR 8, response regulator 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0304 [poplar] [flax] CheY PF00072 [poplar] [flax] Response_reg Response regulator receiver domain
Representative CDS sequence Show only first row Show all	>Potri.001G027000.1 pacid=42791785 polypeptide=Potri.001G027000.1.p locus=Potri.001G027000 ID=Potri.001G027000.1.v4.1 annot-version=v4.1 ATGGCTGTGGAAATGGCTCTGGCTACTACCATGGCTACTGAGACTCAGTTTCATGTTCTTGCTGTTGACGACTGCCTTATTGACAGAAAGTTGATTGAAA GGCTCCTTAAAACCTCTTCTTATCAAGTCACGGCAGTGGATTCAGGAAGCAAGGCCTTGGAGTTTTTGGGCTTGAATGGAGAAAATGAGCTGAGAGATTC AAAACCTGCCTCTGTTTCCCCTGACCCCTATCATCAGCACATTGAAATTAATATGATCATTACAGATTACTGTATGCCAGGAATGACAGGCTATGATCTT CTAAAAAAGATCAAGGAATCTAAATATTTCAAGGACATCCCAGTTGTGATCATGTCCTCAGAGAATGTCCCATCAAGAATCAACAGATGCCTAAAAGAAG GAGCTGAAGAGTTCTTCCTGAAGCCAGTTCAATTATCAGATGTCAACAAGCTTAGACCCCATCTAATGAAGGGAAGATGCAAGGAAGAAGAAGAAGAAGA AGAAGAAGAAGAAGAAGATCAACCCAATAACAAGAGAAAGGGCATGGAAGAAATTGTTAACTCTCCAGATCGAACAAGAACAAGATACAATGATGGCTTG GAAGTTGTCTGA
AA sequence Show only first row Show all	>Potri.001G027000.1 pacid=42791785 polypeptide=Potri.001G027000.1.p locus=Potri.001G027000 ID=Potri.001G027000.1.v4.1 annot-version=v4.1 MAVEMALATTMATETQFHVLAVDDCLIDRKLIERLLKTSSYQVTAVDSGSKALEFLGLNGENELRDSKPASVSPDPYHQHIEINMIITDYCMPGMTGYDL LKKIKESKYFKDIPVVIMSSENVPSRINRCLKEGAEEFFLKPVQLSDVNKLRPHLMKGRCKEEEEEEEEEEEDQPNNKRKGMEEIVNSPDRTRTRYNDGL EVV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G41310		ARR8, ATRR3	RESPONSE REGULATOR 8, response...		Potri.001G027000 [exp]	0	1
AT3G07340	bHLH	bHLH062	basic helix-loop-helix (bHLH) ...		Potri.002G248500 [exp]	4.58	0.7664
AT1G74910			ADP-glucose pyrophosphorylase ...		Potri.012G075500 [exp]	6.48	0.7719
AT5G10020			Leucine-rich receptor-like pro...		Potri.007G082800 [exp]	6.48	0.7473
AT5G44400			FAD-binding Berberine family p...		Potri.011G161600 [exp]	7.48	0.7465
AT5G53750			CBS domain-containing protein ...		Potri.001G402900 [exp]	10.58	0.6903
AT5G64030			S-adenosyl-L-methionine-depend...		Potri.007G104000 [exp]	11.31	0.7918
AT2G19160			Core-2/I-branching beta-1,6-N-...		Potri.018G143900 [exp]	12.16	0.6824
AT1G30760			FAD-binding Berberine family p...		Potri.011G158901 [exp]	17.20	0.7457
AT2G43290		MSS3	multicopy suppressors of snf4 ...		Potri.007G128600 [exp]	18.33	0.7004
AT4G23440			Disease resistance protein (TI...		Potri.003G129600 [exp]	19.44	0.6906

Compare expression of checked genes

Potri.001G027000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.