Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G06730 244 / 1e-83 TRXz, TRXP ,TRX z thioredoxin putative plastidic, Thioredoxin z (.1) AT1G50320 64 / 4e-13 ATHX, ATX thioredoxin X (.1) AT1G43560 62 / 3e-12 ATY2 thioredoxin Y2 (.1) AT3G15360 59 / 9e-11 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT5G60640 59 / 3e-10 ATPDI2, ATPDIL1-4 ARABIDOPSIS THALIANA PROTEIN DISULFIDE ISOMERASE 2, PDI-like 1-4 (.1.2.3) AT4G12170 54 / 2e-09 Thioredoxin superfamily protein (.1) AT3G51030 53 / 2e-09 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT1G76760 54 / 4e-09 ATY1, TRX-Y1 thioredoxin Y1 (.1) AT1G19730 52 / 5e-09 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT4G03520 53 / 6e-09 ATHM2 Thioredoxin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G186800 [exp] 67 / 4e-14 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.002G073000 [exp] 66 / 2e-13 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.007G074000 [exp] 62 / 4e-12 AT1G50320 201 / 3e-66 thioredoxin X (.1) Potri.002G066800 [exp] 61 / 8e-12 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1) Potri.005G058400 [exp] 60 / 3e-11 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2) Potri.009G100700 [exp] 59 / 3e-11 AT2G15570 193 / 2e-63 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Potri.005G193400 [exp] 59 / 4e-11 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1) Potri.009G013600 [exp] 59 / 2e-10 AT5G60640 712 / 0.0 ARABIDOPSIS THALIANA PROTEIN DISULFIDE ISOMERASE 2, PDI-like 1-4 (.1.2.3) Potri.001G401500 [exp] 57 / 2e-10 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039499 [exp] 247 / 2e-84 AT3G06730 238 / 9e-81 thioredoxin putative plastidic, Thioredoxin z (.1) Lus10042784 [exp] 71 / 1e-15 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 71 / 1e-15 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029752 [exp] 71 / 1e-15 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10018875 [exp] 70 / 3e-15 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1) Lus10028569 [exp] 69 / 1e-14 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1) Lus10019847 [exp] 62 / 4e-12 AT2G15570 184 / 8e-60 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10014069 [exp] 59 / 4e-11 AT2G15570 182 / 3e-59 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10014798 [exp] 56 / 5e-10 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10041307 [exp] 57 / 1e-09 AT5G60640 536 / 0.0 ARABIDOPSIS THALIANA PROTEIN DISULFIDE ISOMERASE 2, PDI-like 1-4 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00085 [poplar] [flax] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Potri.001G028500.1 pacid=42790538 polypeptide=Potri.001G028500.1.p locus=Potri.001G028500 ID=Potri.001G028500.1.v4.1 annot-version=v4.1 ATGGCCTTGCTCCAAACCCACTCACTTCACATAAGAACCCTACCATCGACCTTCAAATCACATTCTTTCCTACCTCTTTTTTCATCTCCTCAGTCGTCTT TCAAAACCCATCAAGAAAGCTCTCTTTTTTCTATCACTAGAACACCCAAGAAGAGACCTTTTTCACTCTCTACACAACAAAGAAGACTTCTCTGCAGACC CCCTCAAGGAAAGTACATTAGAGAAGACTATCTTGTGAAAAAGTTGTCAGCTGAGGAGATACAGGAGCTAGTAAAGGGAGAAAGAAACGTGCCCCTTGTT ATTGATTTCTATGCAACATGGTGTGGACCCTGTGTTTTGATGGCCCAAGAACTTGAAATGCTAGCTGTGGAATATGAGAGCAATGTGATGATTGTTAAGG TTGATACAGATGATGAATATGAATTTGCACAAGACATGCAGGTTCGAGGTTTGCCGACCTTGTTTTTCATTAGTCCAGATCCGAACAAGGACGCGATACG GACTGAAGGGCTCATCCCATTACAGATGATGCGGGATATCATTAACAATGAAATGTGA
AA sequence Show only first row Show all	>Potri.001G028500.1 pacid=42790538 polypeptide=Potri.001G028500.1.p locus=Potri.001G028500 ID=Potri.001G028500.1.v4.1 annot-version=v4.1 MALLQTHSLHIRTLPSTFKSHSFLPLFSSPQSSFKTHQESSLFSITRTPKKRPFSLSTQQRRLLCRPPQGKYIREDYLVKKLSAEEIQELVKGERNVPLV IDFYATWCGPCVLMAQELEMLAVEYESNVMIVKVDTDDEYEFAQDMQVRGLPTLFFISPDPNKDAIRTEGLIPLQMMRDIINNEM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G06730		TRXz, TRXP ,TRX...	thioredoxin putative plastidic...		Potri.001G028500 [exp]	0	1
AT3G03630		CS26	cysteine synthase 26 (.1)		Potri.019G045800 [exp]	1.00	0.9929
AT4G24175			unknown protein		Potri.005G240800 [exp]	1.41	0.9842
AT5G66520			Tetratricopeptide repeat (TPR)...		Potri.004G237000 [exp]	2.44	0.9799
AT1G48460			unknown protein		Potri.014G038800 [exp]	2.64	0.9679
AT4G01650			Polyketide cyclase / dehydrase...		Potri.014G110600 [exp]	2.82	0.9795
AT5G63100			S-adenosyl-L-methionine-depend...		Potri.015G082432 [exp]	3.16	0.9699
AT4G29400			Protein of unknown function (D...		Potri.014G148300 [exp]	5.47	0.9684
AT2G44920			Tetratricopeptide repeat (TPR)...		Potri.008G058800 [exp]	6.32	0.9573
AT5G07900			Mitochondrial transcription te...		Potri.014G133200 [exp]	8.48	0.9635
AT5G17660			tRNA (guanine-N-7) methyltrans...		Potri.013G070800 [exp]	9.16	0.9509

Compare expression of checked genes

Potri.001G028500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.