Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38720 102 / 1e-26 MAP65-5 microtubule-associated protein 65-5 (.1) AT5G55230 98 / 4e-25 ATMAP65-1 microtubule-associated proteins 65-1 (.1.2) AT4G26760 86 / 7e-21 MAP65-2 microtubule-associated protein 65-2 (.1) AT1G14690 60 / 1e-11 MAP65-7 microtubule-associated protein 65-7 (.1.2) AT5G51600 60 / 1e-11 ATMAP65-3, PLE PLEIADE, ARABIDOPSIS THALIANA MICROTUBULE-ASSOCIATED PROTEIN 65-3, Microtubule associated protein (MAP65/ASE1) family protein (.1) AT5G62250 57 / 8e-11 MAP65-9 microtubule-associated protein 65-9 (.1) AT1G27920 55 / 6e-10 MAP65-8 microtubule-associated protein 65-8 (.1) AT3G60840 44 / 4e-06 MAP65-4 microtubule-associated protein 65-4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G192400 [exp] 151 / 1e-44 AT2G38720 555 / 0.0 microtubule-associated protein 65-5 (.1) Potri.001G356500 [exp] 97 / 8e-25 AT5G55230 853 / 0.0 microtubule-associated proteins 65-1 (.1.2) Potri.011G092500 [exp] 93 / 3e-23 AT5G55230 863 / 0.0 microtubule-associated proteins 65-1 (.1.2) Potri.003G173300 [exp] 69 / 5e-15 AT1G27920 655 / 0.0 microtubule-associated protein 65-8 (.1) Potri.012G129600 [exp] 67 / 3e-14 AT5G51600 761 / 0.0 PLEIADE, ARABIDOPSIS THALIANA MICROTUBULE-ASSOCIATED PROTEIN 65-3, Microtubule associated protein (MAP65/ASE1) family protein (.1) Potri.015G131400 [exp] 66 / 1e-13 AT5G51600 728 / 0.0 PLEIADE, ARABIDOPSIS THALIANA MICROTUBULE-ASSOCIATED PROTEIN 65-3, Microtubule associated protein (MAP65/ASE1) family protein (.1) Potri.001G055100 [exp] 65 / 1e-13 AT1G27920 623 / 0.0 microtubule-associated protein 65-8 (.1) Potri.008G139700 [exp] 62 / 3e-12 AT2G01910 778 / 0.0 Microtubule associated protein (MAP65/ASE1) family protein (.1), Microtubule associated protein (MAP65/ASE1) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041635 [exp] 120 / 5e-33 AT2G38720 550 / 0.0 microtubule-associated protein 65-5 (.1) Lus10008705 [exp] 119 / 2e-32 AT2G38720 565 / 0.0 microtubule-associated protein 65-5 (.1) Lus10026114 [exp] 118 / 3e-32 AT2G38720 553 / 0.0 microtubule-associated protein 65-5 (.1) Lus10043178 [exp] 100 / 1e-25 AT5G55230 847 / 0.0 microtubule-associated proteins 65-1 (.1.2) Lus10032567 [exp] 97 / 9e-25 AT5G55230 850 / 0.0 microtubule-associated proteins 65-1 (.1.2) Lus10031939 [exp] 58 / 5e-11 AT2G01910 838 / 0.0 Microtubule associated protein (MAP65/ASE1) family protein (.1), Microtubule associated protein (MAP65/ASE1) family protein (.2) Lus10035099 [exp] 57 / 1e-10 AT2G01910 822 / 0.0 Microtubule associated protein (MAP65/ASE1) family protein (.1), Microtubule associated protein (MAP65/ASE1) family protein (.2) Lus10037691 [exp] 56 / 3e-10 AT5G51600 768 / 0.0 PLEIADE, ARABIDOPSIS THALIANA MICROTUBULE-ASSOCIATED PROTEIN 65-3, Microtubule associated protein (MAP65/ASE1) family protein (.1) Lus10015684 [exp] 55 / 6e-10 AT5G51600 759 / 0.0 PLEIADE, ARABIDOPSIS THALIANA MICROTUBULE-ASSOCIATED PROTEIN 65-3, Microtubule associated protein (MAP65/ASE1) family protein (.1) Lus10015789 [exp] 53 / 4e-09 AT1G27920 673 / 0.0 microtubule-associated protein 65-8 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G032683.1 pacid=42791351 polypeptide=Potri.001G032683.1.p locus=Potri.001G032683 ID=Potri.001G032683.1.v4.1 annot-version=v4.1 ATGAACAGCCCAGTTGAGGAGAGAAAATTGGACCAAGTCACTATATTAATCTCATCCTCAGTGGATGATGTATCAAGAAAAGGTTGCCTTGCTGCTGATG TCATTGAGCAGACTGAAGTTGAAGTTGAGAGATTAAATGTTCTCAAACCCGGCAAGATGAAGAAGTTGGTGTTTAAGAAGCAAAATGAGCCGGAGGAAGT CTACAGAGGAGCTCATATGGATGTAGATAGTGATGCTGCAAGGCAGATTCTCATCAGCCTCATAGAATCTGGTTTCAACCAAAACTTCTCTTGTTTTCAT TTGACTAAAATGCATGATGGCTAA
AA sequence Show only first row Show all	>Potri.001G032683.1 pacid=42791351 polypeptide=Potri.001G032683.1.p locus=Potri.001G032683 ID=Potri.001G032683.1.v4.1 annot-version=v4.1 MNSPVEERKLDQVTILISSSVDDVSRKGCLAADVIEQTEVEVERLNVLKPGKMKKLVFKKQNEPEEVYRGAHMDVDSDAARQILISLIESGFNQNFSCFH LTKMHDG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G38720		MAP65-5	microtubule-associated protein...		Potri.001G032683 [exp]	0	1
					Potri.014G177901 [exp]	3.46	0.8767
					Potri.013G075801 [exp]	3.87	0.8638
AT1G08620		PKDM7D	Transcription factor jumonji (...		Potri.002G037300 [exp]	27.96	0.8318
AT5G08110			nucleic acid binding;ATP-depen...		Potri.012G063500 [exp]	40.24	0.7907
AT5G36930			Disease resistance protein (TI...		Potri.011G014301 [exp]	56.86	0.8525
AT2G36720			Acyl-CoA N-acyltransferase wit...		Potri.016G097300 [exp]	73.26	0.8152
AT3G18290		BTS, EMB2454	embryo defective 2454, BRUTUS,...		Potri.010G122200 [exp]	77.13	0.7816
AT3G14470			NB-ARC domain-containing disea...		Potri.012G123000 [exp]	82.55	0.8422
AT1G31040			PLATZ transcription factor fam...		Potri.001G159200 [exp]	86.72	0.8137
AT1G25350		OVA9	ovule abortion 9, glutamine-tR...		Potri.010G122866 [exp]	92.68	0.8133

Compare expression of checked genes

Potri.001G032683 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.