Potri.001G034400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12390 204 / 4e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
AT5G13850 191 / 8e-62 NACA3 nascent polypeptide-associated complex subunit alpha-like protein 3 (.1)
AT3G49470 184 / 9e-59 NACA2 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
AT4G10480 179 / 4e-57 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1), Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.2)
AT1G33040 171 / 5e-54 NACA5 nascent polypeptide-associated complex subunit alpha-like protein 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G190800 280 / 5e-97 AT3G12390 204 / 7e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.006G032000 236 / 1e-79 AT3G12390 215 / 2e-71 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.015G003300 191 / 2e-61 AT3G49470 172 / 4e-54 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Potri.012G006700 176 / 1e-55 AT3G49470 171 / 1e-53 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026133 239 / 6e-82 AT3G12390 204 / 2e-68 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10041610 234 / 9e-79 AT3G12390 229 / 7e-77 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10008687 230 / 1e-74 AT3G15660 197 / 7e-62 A. THALIANA GLUTAREDOXIN 4, glutaredoxin 4 (.1.2)
Lus10024109 219 / 1e-73 AT3G12390 198 / 1e-65 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10015579 181 / 2e-57 AT3G49470 260 / 1e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Lus10032927 180 / 2e-57 AT3G49470 260 / 2e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
Representative CDS sequence
>Potri.001G034400.1 pacid=42793317 polypeptide=Potri.001G034400.1.p locus=Potri.001G034400 ID=Potri.001G034400.1.v4.1 annot-version=v4.1
ATGACTGCCCAAACTCAAGAAGAGCTCCTTGCTGCCCAGCTCGAAATTCAGAAGATTCTCGAAGCTGATAAGCCCGAGGTTGAGGATGAAGAGGATGACG
AGGAGGATGACGATGAAGATGATGACAAGGATGAAGACGAAGCTGAAGGACAACAAGATGGAGATGCAAGTGGTAGATCAAAACAAAGCAGAAGTGAAAA
GAAGAGTCGTAAAGCTATGTTGAAGCTTGGAATGAAAACTATCCCTGGTGTTAGTCGGGTTACAGTAAAAAAGAGCAAGAATATCTTGTTTGTTATCTCC
AAACCTGATGTTTTCAAGAGCCCAACATCTGACACATATGTGATCTTTGGGGAGGCGAAGATCGAGGACTTGAGCTCCCAACTACAAACTCAGGCAGCAG
AGCAGTTCAAGGCACCTGATCTCAGTCATGTGATTTCAAAACCTGAGACTTCAGCCGTGGCTCAGGATGACGAAGAGGTAGATGAAACTGGCGTGGAGCC
AAAGGATATTGAATTAGTGATGACCCAGGCGGGAGTCTCCAGATCAAAGGCTGTCAAAGCTCTGAAGGCTGCAGATGGAGACATCGTTTCTGCAATCATG
GATCTGACCACTTGA
AA sequence
>Potri.001G034400.1 pacid=42793317 polypeptide=Potri.001G034400.1.p locus=Potri.001G034400 ID=Potri.001G034400.1.v4.1 annot-version=v4.1
MTAQTQEELLAAQLEIQKILEADKPEVEDEEDDEEDDDEDDDKDEDEAEGQQDGDASGRSKQSRSEKKSRKAMLKLGMKTIPGVSRVTVKKSKNILFVIS
KPDVFKSPTSDTYVIFGEAKIEDLSSQLQTQAAEQFKAPDLSHVISKPETSAVAQDDEEVDETGVEPKDIELVMTQAGVSRSKAVKALKAADGDIVSAIM
DLTT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G12390 Nascent polypeptide-associated... Potri.001G034400 0 1
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Potri.005G072700 1.41 0.9714
AT3G27080 TOM20-3 translocase of outer membrane ... Potri.003G173400 2.44 0.9624 Pt-TOM20.2
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.015G094400 3.74 0.9725 RPL17.2
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Potri.018G115400 4.00 0.9613 Pt-RPS11.3
AT5G35530 Ribosomal protein S3 family pr... Potri.006G222100 5.29 0.9649
AT5G28060 Ribosomal protein S24e family ... Potri.008G152500 5.91 0.9643
AT3G04840 Ribosomal protein S3Ae (.1) Potri.008G156300 6.24 0.9691 RS3.2
AT1G26910 RPL10B ribosomal protein L10 B, Ribos... Potri.019G131900 7.61 0.9453 Pt-RPL10.4
AT5G27990 Pre-rRNA-processing protein TS... Potri.005G047901 9.16 0.9460
AT2G34480 Ribosomal protein L18ae/LX fam... Potri.002G057600 9.89 0.9616 RPL18.7

Potri.001G034400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.