Potri.001G034500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 208 / 1e-63 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 169 / 6e-49 Mitochondrial transcription termination factor family protein (.1)
AT5G64950 141 / 3e-38 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 121 / 7e-31 Mitochondrial transcription termination factor family protein (.1.2)
AT1G61980 113 / 8e-28 Mitochondrial transcription termination factor family protein (.1)
AT3G46950 108 / 3e-26 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 106 / 2e-25 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 106 / 2e-25 Mitochondrial transcription termination factor family protein (.1)
AT1G62010 102 / 5e-24 Mitochondrial transcription termination factor family protein (.1)
AT1G56380 100 / 1e-23 Mitochondrial transcription termination factor family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G034966 438 / 6e-154 AT5G07900 201 / 1e-60 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190700 417 / 7e-146 AT5G07900 213 / 3e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034900 412 / 8e-144 AT5G07900 184 / 2e-54 Mitochondrial transcription termination factor family protein (.1)
Potri.004G222000 405 / 4e-141 AT5G07900 200 / 1e-60 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034700 402 / 8e-140 AT5G07900 202 / 2e-61 Mitochondrial transcription termination factor family protein (.1)
Potri.001G035200 391 / 1e-135 AT5G07900 168 / 3e-48 Mitochondrial transcription termination factor family protein (.1)
Potri.003G189300 392 / 2e-135 AT5G07900 178 / 6e-52 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034933 388 / 3e-134 AT5G07900 194 / 3e-58 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190300 377 / 1e-129 AT5G07900 209 / 8e-64 Mitochondrial transcription termination factor family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008688 302 / 2e-100 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10036450 171 / 1e-49 AT5G07900 176 / 3e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 169 / 1e-48 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 159 / 5e-45 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 157 / 1e-44 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 157 / 3e-44 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10041122 150 / 9e-42 AT5G07900 166 / 2e-47 Mitochondrial transcription termination factor family protein (.1)
Lus10028912 148 / 5e-41 AT5G64950 249 / 1e-79 Mitochondrial transcription termination factor family protein (.1)
Lus10004329 143 / 4e-39 AT5G64950 238 / 2e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10002883 135 / 1e-35 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Potri.001G034500.1 pacid=42787751 polypeptide=Potri.001G034500.1.p locus=Potri.001G034500 ID=Potri.001G034500.1.v4.1 annot-version=v4.1
ATGGCTAACCACGTACCCCTCAGAAGCCTACTCCTGCTCTCTCTGATTCAAAAACGTTTCTTGAAAACATCTGCATCACCGTCATCATTTAAGGTTCAAT
ACCTCATCGATTCATGCGGGCTTCCTTCACAGTTGGCCCTTTCAACTTACCAGAAGCTCCAACACGACAAGAAGAACCTCCCAAATGCTTATTCTGTGCT
TCAGTACTTGAAAGATCATGACTTTAGCAACACCCACATTTCCAAACTAATCGACAAGTATCCCCGAGTCCTTCAAGTCAGAGTGGGAAGCAATCTAAAA
CCCAAATTCGACTTCTTCACTGAAAATGGGTTTGTGGGTCAGCTTCTGCCTCAGCTTATTCTATCAAATCCGTCTGTTTTGAGAAGAGCTTTAGATTCTC
AAATAAAACCATGTTTTGAGTTATTGAACTCACTTCTTGGTTGTAAGGAGAACCTTGTAGTGGCTCTTAAGCGTGCTTCTTGGCTGTTGACGGTGAATCT
TAAGGTTGTTATTCAACCAAATGTTGATTTGTTGATTAAAGAGGGATTGCCTCTTGATAGGGTTGCAAAGCTAATTCTCTGGCAACCAAGAGCTGTACTA
CAAAAGATGGACAGGATGGTTTATGCATTACATGCTCTTAAGAGTATGGGCCTTGATGTAGAGGATAATATCTTTATACATGCTCTTCGCGTGAGGATAC
AGTTGCCTGAAACGACTTGGAAGAAGAAAATTGAAGGGATGAAGAGTTCGCAGTGGAGTGAAGAGGAGATTTTGGGGGCTTTTAAGCGCTACCCCCCAAT
ACTAGCATTGTCAGAGAAGAAAATCAGGAGTTCAATGGATTTCTTTATCAATACAATGGAGCTGGAGAGACAAAACATAATTGCCTGTCCCCTTTTTCTT
GGCTATTCAATTGATAAAAGGGTTCGTCCAAGGTATAATGTTATAAAGGTTTTGAAGTCGAAGAAGCTGACAAGTAGAGACAAGAAGATGACTACTTTGC
TAACAATAAACGAGAAGAATTTCTTGACAAATTATGTCCACAGGTATGTAGATGTAGTCCCTGGTTTATTGGAGCTGTACATGGGTAATGGTAAGACAAA
AAAGAAAGATAGTTGA
AA sequence
>Potri.001G034500.1 pacid=42787751 polypeptide=Potri.001G034500.1.p locus=Potri.001G034500 ID=Potri.001G034500.1.v4.1 annot-version=v4.1
MANHVPLRSLLLLSLIQKRFLKTSASPSSFKVQYLIDSCGLPSQLALSTYQKLQHDKKNLPNAYSVLQYLKDHDFSNTHISKLIDKYPRVLQVRVGSNLK
PKFDFFTENGFVGQLLPQLILSNPSVLRRALDSQIKPCFELLNSLLGCKENLVVALKRASWLLTVNLKVVIQPNVDLLIKEGLPLDRVAKLILWQPRAVL
QKMDRMVYALHALKSMGLDVEDNIFIHALRVRIQLPETTWKKKIEGMKSSQWSEEEILGAFKRYPPILALSEKKIRSSMDFFINTMELERQNIIACPLFL
GYSIDKRVRPRYNVIKVLKSKKLTSRDKKMTTLLTINEKNFLTNYVHRYVDVVPGLLELYMGNGKTKKKDS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G07900 Mitochondrial transcription te... Potri.001G034500 0 1
AT5G23340 RNI-like superfamily protein (... Potri.007G075600 1.00 0.9291
AT3G62470 Pentatricopeptide repeat (PPR)... Potri.014G121400 2.44 0.9237
AT1G21740 Protein of unknown function (D... Potri.005G070200 6.32 0.8500
AT5G17900 microfibrillar-associated prot... Potri.013G065600 6.70 0.8985
AT4G18520 Pentatricopeptide repeat (PPR)... Potri.002G091101 8.06 0.9096
AT1G44835 YbaK/aminoacyl-tRNA synthetase... Potri.002G085700 9.16 0.8796
AT1G26650 unknown protein Potri.008G091500 12.00 0.8447
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Potri.013G104100 15.09 0.8684
AT5G18900 2-oxoglutarate (2OG) and Fe(II... Potri.010G027201 15.87 0.8487
AT3G42170 BED zinc finger ;hAT family di... Potri.004G126780 17.49 0.8774

Potri.001G034500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.