Potri.001G034600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 197 / 3e-59 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 168 / 2e-48 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 134 / 2e-35 Mitochondrial transcription termination factor family protein (.1.2)
AT5G64950 131 / 1e-34 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 127 / 8e-33 Mitochondrial transcription termination factor family protein (.1)
AT5G23930 126 / 3e-32 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 120 / 3e-30 Mitochondrial transcription termination factor family protein (.1)
AT1G62010 111 / 5e-27 Mitochondrial transcription termination factor family protein (.1)
AT3G46950 107 / 1e-25 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 105 / 6e-25 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G034933 393 / 7e-136 AT5G07900 194 / 3e-58 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034700 385 / 7e-133 AT5G07900 202 / 2e-61 Mitochondrial transcription termination factor family protein (.1)
Potri.001G035000 385 / 1e-132 AT5G07900 209 / 7e-64 Mitochondrial transcription termination factor family protein (.1)
Potri.004G222000 382 / 7e-132 AT5G07900 200 / 1e-60 Mitochondrial transcription termination factor family protein (.1)
Potri.001G030300 382 / 2e-131 AT5G07900 190 / 2e-56 Mitochondrial transcription termination factor family protein (.1)
Potri.003G189300 379 / 3e-130 AT5G07900 178 / 6e-52 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190300 374 / 3e-128 AT5G07900 209 / 8e-64 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034500 363 / 2e-124 AT5G07900 208 / 2e-63 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190400 362 / 7e-124 AT5G07900 206 / 9e-63 Mitochondrial transcription termination factor family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008688 303 / 1e-100 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 179 / 1e-52 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 179 / 2e-52 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 174 / 1e-50 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 170 / 5e-49 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10036450 169 / 2e-48 AT5G07900 176 / 3e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10041122 160 / 4e-45 AT5G07900 166 / 2e-47 Mitochondrial transcription termination factor family protein (.1)
Lus10002883 151 / 8e-42 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10004329 138 / 4e-37 AT5G64950 238 / 2e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10028912 134 / 2e-35 AT5G64950 249 / 1e-79 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Potri.001G034600.1 pacid=42787599 polypeptide=Potri.001G034600.1.p locus=Potri.001G034600 ID=Potri.001G034600.1.v4.1 annot-version=v4.1
ATGGCCGCCACGAGGAACTTCATATCTTTGTTGCAAAGACGATGTATACAGACATCTGCTGCTTCACTTTGTTCTAATTCTTCTCCACTATCCACTAACT
CGTCTTCTTCTTTATCTTCATCATCATCATTTACAGTTAAGTTCCTCGTCAATTCATGCGGGCTTCCTTTAAAATCCGCTCTTTCAGTTTCTAAAAAGTT
CCAAATCCATGAAAAGGAACTCCATAAGTCCCTTTCTGTACTTGAGTTCTTGAAAGCTCACGACTTTAACGAGACCCAGATAGGCAGATTGATCGAAAAG
TGGCCCCGTGTCCTCCTCTGCAGAGTAGAAAGCACCCTCAAGCTCAAGTTCGATTTCCTCACTCAGAACGGTTTTTCGGGTCAGATTCTGCCTCAGCTTA
TCGTCTTAGTTCCGGCGATTTTGAATAGGAAGGTAGATTCTTGTATTAAGCCATGCTTTGAGTTTTTGAAGTCCTTTCTTGACAACAATGAGAAACTTTT
AGCAGCTATTAAGCGTTATCCGTGGTATTTTACCTTTAATTTCAATTCTGCTCTGAAACCAAATACTGTTTTCTTGATAAAAGAGGGAGTGCCTCATGAT
AGGGTTGCGAAACTGATTTTGATGTATCCGAGAACTTTACAGATGAAACCTGATAGGATGGTCCGTGTAGTGAATTCTGTTAAGAATCTGGGCCTTGAAC
CAAAGGCTCCTGTGTTTGTACATGCTCTTAGAGTGATGATAGGAATGAGTGAATCCACTTGGAAGAGGAAAATTGAGTATATGAAGAGTTTGGGGTGGAC
TGAAGATGAGGTTTTGCTGACCTTTAAACGAAATCCAGATATACTGGCATGCTCGGAGGACAAAATCGGGAGGGCCATGGATTTCTTTGTGAATACTGTG
AGATTAGGATCACAAACTGTAGTTGCAAATCCAGTTTTACTCCAGTACTCAATTGATAAAAGGGTTCGTCCGAGGTATAATGTTTTGAAGGTTTTGGAGT
CAAAGAATCTGATCGAAGTGAACCAGAGGGTTTTTTGGTTGCTAACAACAAGAAGTGAGATGAAATTCCGGGAAAATTATGTTGCAAGGTATGCAGATAA
AGTACCAGGCTTATTGGAGATATATCGCGGTACTGTGGAAGCAAAAAAGATAGATACTTGA
AA sequence
>Potri.001G034600.1 pacid=42787599 polypeptide=Potri.001G034600.1.p locus=Potri.001G034600 ID=Potri.001G034600.1.v4.1 annot-version=v4.1
MAATRNFISLLQRRCIQTSAASLCSNSSPLSTNSSSSLSSSSSFTVKFLVNSCGLPLKSALSVSKKFQIHEKELHKSLSVLEFLKAHDFNETQIGRLIEK
WPRVLLCRVESTLKLKFDFLTQNGFSGQILPQLIVLVPAILNRKVDSCIKPCFEFLKSFLDNNEKLLAAIKRYPWYFTFNFNSALKPNTVFLIKEGVPHD
RVAKLILMYPRTLQMKPDRMVRVVNSVKNLGLEPKAPVFVHALRVMIGMSESTWKRKIEYMKSLGWTEDEVLLTFKRNPDILACSEDKIGRAMDFFVNTV
RLGSQTVVANPVLLQYSIDKRVRPRYNVLKVLESKNLIEVNQRVFWLLTTRSEMKFRENYVARYADKVPGLLEIYRGTVEAKKIDT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G07900 Mitochondrial transcription te... Potri.001G034600 0 1
AT3G13226 regulatory protein RecX family... Potri.001G467400 1.00 0.8487
AT1G56190 Phosphoglycerate kinase family... Potri.016G091800 1.73 0.8344
AT1G80480 PTAC17 plastid transcriptionally acti... Potri.001G133500 3.74 0.8122
AT5G10530 Concanavalin A-like lectin pro... Potri.001G283200 7.21 0.8382
AT2G24030 zinc ion binding;nucleic acid ... Potri.006G182601 12.96 0.7889
AT2G23470 RUS4 ROOT UV-B SENSITIVE 4, Protein... Potri.007G035300 15.49 0.7650
AT3G18370 NTMCTYPE3, ATSY... C2 domain-containing protein (... Potri.015G046700 16.52 0.7987
AT4G12750 Homeodomain-like transcription... Potri.014G173300 17.32 0.8315
AT5G46460 Pentatricopeptide repeat (PPR)... Potri.001G354400 22.89 0.8327
AT5G15270 RNA-binding KH domain-containi... Potri.017G114400 22.91 0.8077

Potri.001G034600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.