Potri.001G035300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 134 / 2e-35 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 118 / 7e-30 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 97 / 5e-22 Mitochondrial transcription termination factor family protein (.1.2)
AT3G46950 95 / 3e-21 Mitochondrial transcription termination factor family protein (.1)
AT5G64950 87 / 1e-18 Mitochondrial transcription termination factor family protein (.1)
AT1G62085 85 / 6e-18 Mitochondrial transcription termination factor family protein (.1)
AT1G61960 85 / 8e-18 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 82 / 5e-17 Mitochondrial transcription termination factor family protein (.1)
AT5G23930 79 / 9e-16 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 78 / 9e-16 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G035000 296 / 7e-98 AT5G07900 209 / 7e-64 Mitochondrial transcription termination factor family protein (.1)
Potri.003G189300 293 / 9e-97 AT5G07900 178 / 6e-52 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034900 286 / 3e-94 AT5G07900 184 / 2e-54 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034933 286 / 4e-94 AT5G07900 194 / 3e-58 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034966 283 / 7e-93 AT5G07900 201 / 1e-60 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034700 283 / 8e-93 AT5G07900 202 / 2e-61 Mitochondrial transcription termination factor family protein (.1)
Potri.001G030300 278 / 7e-91 AT5G07900 190 / 2e-56 Mitochondrial transcription termination factor family protein (.1)
Potri.001G029400 271 / 4e-88 AT5G07900 181 / 4e-53 Mitochondrial transcription termination factor family protein (.1)
Potri.004G222000 266 / 2e-86 AT5G07900 200 / 1e-60 Mitochondrial transcription termination factor family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008688 233 / 2e-73 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10002883 133 / 4e-35 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 128 / 2e-33 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 128 / 3e-33 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 127 / 6e-33 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 127 / 6e-33 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10036450 109 / 1e-26 AT5G07900 176 / 3e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10040819 105 / 4e-26 AT5G07900 130 / 2e-35 Mitochondrial transcription termination factor family protein (.1)
Lus10016551 100 / 8e-24 AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
Lus10028912 100 / 3e-23 AT5G64950 249 / 1e-79 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Potri.001G035300.1 pacid=42788345 polypeptide=Potri.001G035300.1.p locus=Potri.001G035300 ID=Potri.001G035300.1.v4.1 annot-version=v4.1
ATGAGAAGCCTGCTTTCTCTTATGCATAAACGTTTTCTATCAAGTAGCCCACCACCATCATCATCATTTACAGTTGAGTGCCTCGTAAACTCATGTGGGC
TTCCCTCAAAATCAGCTCTTGAATTCTCCCGAGACTTCCACCTGCATGAAAACAACCTCCAAAGCTTCCAATCTGTATTCCGCTGCTTCCAGTCCCACAA
CATTCCCAGCATCCGCATAACCAAATTGATTAAAAGGCGGCCTCAAATCCTCAATTACAATGTAGAAGACAACCTCAAGCCTAAACTCCAGCTCCTCGTG
CAAAATGGCATCGTGGGTCATCACATGTGCAAGGTTTTCGTATCAAATCCGGTAATTTTGAACGCTGACTTAGATTCTCAAATTAAACCATGTTTTCAGT
TTTTAAAGTCTGTTCTTGGTAGTAATAGGAATGTCGTAGAAGCTATCAATCGTTCTTCCAATTTGCTGACTTGTGATTTGAAGGGTTGTTTGAAACCAAA
TATTGATTTTTTGATTAGAGAGGGAGTGCCTTTTGATGGGGTTGCTGAATTTCTTATTAGGGACGCAATAACTGTACAGCACAAGCATAATAGTATGGTC
AATGCAGTGAATGATCTTAAGAATCTGGGATTTGATCCAAAGGCTCCTGTTTTTCTTGAGGCTGTTAGAGTGAGGATTCACATGAGTGAGTCAATTTGGA
GGGAGAAAATTGAAGTGATGAAGAGTTTGGGGTGGAGTGAAGAGGAGATTTTTTCGGCTTTTAAGCGAGATCCGATTTTTTTAAAATCCCCAGTAGAGAA
AATCAGGGTGGCGACGGATTTCTTTGTGAATACATTGAAATTGGGACGGCAAATTTTAAGTGAAGATCCTGAATTTTTTACCCTTAAAATTGATAAAAGT
TGTCGAAGGAGGTATGATGTTTTCAAACTTTTGGAGTCGGAGAAGCTGCTCGAAGGTGGTGTGAAGATTGAGGAAGTGCTCAAAATGAGGGATAAGGAGT
TCTTGGTGAAATACGTTAAGAAGTATGTGGACAAAGTCCCAGGTTTATGGGAGACTTTCAATGGTAGGAAGCAACAACAATCTTTACCCGGTCTAACAGA
GCAATGGGGAAAAGCAGCTCGTTGTGAGTAG
AA sequence
>Potri.001G035300.1 pacid=42788345 polypeptide=Potri.001G035300.1.p locus=Potri.001G035300 ID=Potri.001G035300.1.v4.1 annot-version=v4.1
MRSLLSLMHKRFLSSSPPPSSSFTVECLVNSCGLPSKSALEFSRDFHLHENNLQSFQSVFRCFQSHNIPSIRITKLIKRRPQILNYNVEDNLKPKLQLLV
QNGIVGHHMCKVFVSNPVILNADLDSQIKPCFQFLKSVLGSNRNVVEAINRSSNLLTCDLKGCLKPNIDFLIREGVPFDGVAEFLIRDAITVQHKHNSMV
NAVNDLKNLGFDPKAPVFLEAVRVRIHMSESIWREKIEVMKSLGWSEEEIFSAFKRDPIFLKSPVEKIRVATDFFVNTLKLGRQILSEDPEFFTLKIDKS
CRRRYDVFKLLESEKLLEGGVKIEEVLKMRDKEFLVKYVKKYVDKVPGLWETFNGRKQQQSLPGLTEQWGKAARCE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G07900 Mitochondrial transcription te... Potri.001G035300 0 1
AT1G60770 Tetratricopeptide repeat (TPR)... Potri.018G079600 8.12 0.8057
AT4G16180 unknown protein Potri.010G146800 12.00 0.7475
AT3G04580 EIN4 ETHYLENE INSENSITIVE 4, Signal... Potri.013G044100 18.00 0.7247 Pt-EIN4.3
AT5G58100 unknown protein Potri.006G080700 21.63 0.7684
AT5G04930 ALA1 aminophospholipid ATPase 1 (.1... Potri.006G109200 21.90 0.7959
AT4G27585 SPFH/Band 7/PHB domain-contain... Potri.012G010001 29.69 0.7505
AT1G54215 proline-rich family protein (.... Potri.001G169200 36.98 0.6523
AT4G35870 early-responsive to dehydratio... Potri.007G063700 37.94 0.6784
AT5G15740 RRT1 O-fucosyltransferase family pr... Potri.012G064200 40.24 0.6891
AT5G61450 P-loop containing nucleoside t... Potri.001G125700 42.24 0.7331

Potri.001G035300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.