Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19110 305 / 1e-103 Protein kinase superfamily protein (.1.2.3) AT5G45430 305 / 3e-102 Protein kinase superfamily protein (.1.2) AT4G13020 238 / 2e-77 MHK Protein kinase superfamily protein (.1.2.3.4.5) AT3G48750 142 / 3e-41 CDKA1, CDC2A, CDKA;1, CDC2AAT, CDK2 cell division control 2 (.1) AT1G73690 144 / 5e-41 CDKD1;1, AT;CDKD;1, CAK3AT cyclin-dependent kinase D1;1 (.1) AT5G63370 145 / 8e-41 CDKG;1 Protein kinase superfamily protein (.1.2.3.4) AT4G11330 142 / 2e-40 ATMPK5 MAP kinase 5 (.1) AT1G67580 146 / 3e-40 CDKG;2 Protein kinase superfamily protein (.1.2) AT1G18040 142 / 4e-40 CDKD1;3, AT;CDCKD;3, CAK2AT cyclin-dependent kinase D1;3 (.1) AT2G38620 139 / 4e-40 CDKB1;2 cyclin-dependent kinase B1;2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G190200 [exp] 361 / 4e-125 AT4G19110 508 / 5e-179 Protein kinase superfamily protein (.1.2.3) Potri.010G154400 [exp] 353 / 4e-123 AT4G19110 451 / 4e-158 Protein kinase superfamily protein (.1.2.3) Potri.016G012801 [exp] 353 / 5e-123 AT4G19110 452 / 3e-158 Protein kinase superfamily protein (.1.2.3) Potri.003G101600 [exp] 317 / 1e-107 AT4G19110 689 / 0.0 Protein kinase superfamily protein (.1.2.3) Potri.002G247500 [exp] 251 / 4e-82 AT4G13020 629 / 0.0 Protein kinase superfamily protein (.1.2.3.4.5) Potri.004G133500 [exp] 153 / 2e-45 AT3G48750 540 / 0.0 cell division control 2 (.1) Potri.005G119500 [exp] 139 / 2e-39 AT2G18170 662 / 0.0 MAP kinase 7 (.1) Potri.002G003400 [exp] 138 / 2e-39 AT1G76540 553 / 0.0 cyclin-dependent kinase B2;1 (.1) Potri.007G139800 [exp] 137 / 2e-38 AT2G43790 684 / 0.0 MAP kinase 6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038123 [exp] 306 / 3e-102 AT4G19110 555 / 0.0 Protein kinase superfamily protein (.1.2.3) Lus10008303 [exp] 304 / 7e-102 AT4G19110 616 / 0.0 Protein kinase superfamily protein (.1.2.3) Lus10033278 [exp] 303 / 4e-101 AT4G19110 620 / 0.0 Protein kinase superfamily protein (.1.2.3) Lus10003155 [exp] 253 / 1e-82 AT4G13020 629 / 0.0 Protein kinase superfamily protein (.1.2.3.4.5) Lus10038472 [exp] 140 / 2e-39 AT3G45640 535 / 0.0 mitogen-activated protein kinase 3 (.1) Lus10007921 [exp] 139 / 2e-39 AT4G01370 689 / 0.0 MAP kinase 4 (.1) Lus10036384 [exp] 138 / 7e-39 AT4G01370 681 / 0.0 MAP kinase 4 (.1) Lus10021611 [exp] 136 / 1e-38 AT1G76540 531 / 0.0 cyclin-dependent kinase B2;1 (.1) Lus10040593 [exp] 136 / 1e-38 AT1G76540 534 / 0.0 cyclin-dependent kinase B2;1 (.1) Lus10008339 [exp] 137 / 4e-38 AT2G43790 691 / 0.0 MAP kinase 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.001G035400.1 pacid=42792554 polypeptide=Potri.001G035400.1.p locus=Potri.001G035400 ID=Potri.001G035400.1.v4.1 annot-version=v4.1 ATGGAAAAGAACCTTTATCAAGTCATTGAAGACAGGAAAACCCGGTTCACAGGAGCAGAAATCAGGAACTTGTGTCGCCAGGTGTTTCAGGGTCTTGATT ACATGCACAAGCAAGGTTATTTTCACCGTGACCTGAAGCCAGAGAACTTCTTGGTTACCAGAGACGCTGTCAAGATTGCCGACTTTGGTCTTGCAAGAGA AATCAATTCAAAACCTCCATATACACAATATGTCTGCTCTCGCTGGTATCGAGCGCCTGAAAATATCCTGCACTCGTATTCTTATAGTTCTAAAGTTGAT ATGTGGGCTATGGGTGCTATCATGGCTGAGTTATTCAATCTATGTCCACTCTTTCCTGGTACCAGTGGAGCAAACCAGATGTACAGAATATGCAGTGTAC GAGGCACTCCAAATATGGATTCATGGGCTGAAGGAAATCATCTCGCGAGGACTATTAAGTACAAATTTCCAAAGTTTGATGGTGCCCGGCTTTCTGCAGT GATACCTTCTGCTAGTAAGGATGCTATCAACCTTATTTCAATGCTTATTTCTTGGAATCCTTGCGATCGGCCCACCGCTGAGGAGGCCTTAAAACATCCT TTCTTCAGGAGTGGCTTCTATATTCCTCCTTCCGGCCACCGCTTATGGCTGCAATTCTATCAGCCAGAAAAAGCGGCCAATTAG
AA sequence Show only first row Show all	>Potri.001G035400.1 pacid=42792554 polypeptide=Potri.001G035400.1.p locus=Potri.001G035400 ID=Potri.001G035400.1.v4.1 annot-version=v4.1 MEKNLYQVIEDRKTRFTGAEIRNLCRQVFQGLDYMHKQGYFHRDLKPENFLVTRDAVKIADFGLAREINSKPPYTQYVCSRWYRAPENILHSYSYSSKVD MWAMGAIMAELFNLCPLFPGTSGANQMYRICSVRGTPNMDSWAEGNHLARTIKYKFPKFDGARLSAVIPSASKDAINLISMLISWNPCDRPTAEEALKHP FFRSGFYIPPSGHRLWLQFYQPEKAAN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G19110			Protein kinase superfamily pro...		Potri.001G035400 [exp]	0	1
					Potri.001G035450 [exp]	1.00	0.9612
AT3G11810			unknown protein		Potri.010G163300 [exp]	2.23	0.9285
AT1G26880			Ribosomal protein L34e superfa...		Potri.012G108301 [exp]	2.82	0.9398
AT1G04555			unknown protein		Potri.008G173000 [exp]	4.00	0.9306
AT5G61370			Pentatricopeptide repeat (PPR)...		Potri.012G068400 [exp]	6.70	0.9331
AT5G22510		INV-E, At-A/N-I...	Arabidopsis alkaline/neutral i...		Potri.004G186500 [exp]	7.93	0.9244
AT1G43760			DNAse I-like superfamily prote...		Potri.002G000350 [exp]	8.48	0.9271
AT2G42760			unknown protein		Potri.011G069900 [exp]	8.94	0.9231
AT2G13690			PRLI-interacting factor, putat...		Potri.007G109300 [exp]	9.21	0.9147
AT2G13690			PRLI-interacting factor, putat...		Potri.005G058700 [exp]	16.27	0.8972

Compare expression of checked genes

Potri.001G035400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.