Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G21150 70 / 3e-14 Mitochondrial transcription termination factor family protein (.1) AT1G61990 56 / 3e-09 Mitochondrial transcription termination factor family protein (.1) AT1G61960 49 / 4e-07 Mitochondrial transcription termination factor family protein (.1) AT1G79220 49 / 8e-07 Mitochondrial transcription termination factor family protein (.1) AT1G62085 43 / 6e-05 Mitochondrial transcription termination factor family protein (.1) AT1G78930 40 / 0.0006 Mitochondrial transcription termination factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G035000 [exp] 228 / 4e-74 AT5G07900 209 / 7e-64 Mitochondrial transcription termination factor family protein (.1) Potri.001G034600 [exp] 224 / 1e-72 AT5G07900 197 / 4e-59 Mitochondrial transcription termination factor family protein (.1) Potri.001G035200 [exp] 219 / 7e-71 AT5G07900 168 / 3e-48 Mitochondrial transcription termination factor family protein (.1) Potri.001G030300 [exp] 216 / 2e-69 AT5G07900 190 / 2e-56 Mitochondrial transcription termination factor family protein (.1) Potri.001G034700 [exp] 211 / 2e-67 AT5G07900 202 / 2e-61 Mitochondrial transcription termination factor family protein (.1) Potri.003G189300 [exp] 206 / 2e-65 AT5G07900 178 / 6e-52 Mitochondrial transcription termination factor family protein (.1) Potri.001G034900 [exp] 205 / 3e-65 AT5G07900 184 / 2e-54 Mitochondrial transcription termination factor family protein (.1) Potri.001G034966 [exp] 204 / 6e-65 AT5G07900 201 / 1e-60 Mitochondrial transcription termination factor family protein (.1) Potri.001G034933 [exp] 202 / 3e-64 AT5G07900 194 / 3e-58 Mitochondrial transcription termination factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008688 [exp] 176 / 5e-54 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1) Lus10028912 [exp] 85 / 2e-19 AT5G64950 249 / 1e-79 Mitochondrial transcription termination factor family protein (.1) Lus10040820 [exp] 81 / 4e-18 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1) Lus10016553 [exp] 78 / 2e-17 AT5G07900 171 / 7e-51 Mitochondrial transcription termination factor family protein (.1) Lus10040817 [exp] 76 / 4e-16 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1) Lus10004957 [exp] 73 / 4e-15 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1) Lus10016550 [exp] 70 / 5e-14 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1) Lus10029199 [exp] 67 / 5e-13 AT5G64950 226 / 1e-70 Mitochondrial transcription termination factor family protein (.1) Lus10031184 [exp] 56 / 3e-09 AT1G79220 354 / 2e-120 Mitochondrial transcription termination factor family protein (.1) Lus10031762 [exp] 56 / 4e-09 AT1G79220 353 / 4e-120 Mitochondrial transcription termination factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02536 [poplar] [flax] mTERF mTERF
Representative CDS sequence Show only first row Show all	>Potri.001G035600.2 pacid=42793463 polypeptide=Potri.001G035600.2.p locus=Potri.001G035600 ID=Potri.001G035600.2.v4.1 annot-version=v4.1 ATGCAACCAAATATTGATTTGTTGATAAAAGAGGGGGTAACTTTTGATAGGGTAGCAAAACTGATTATCTCACAACCAGGAGCCATACAGCAAAAGCATT CTAGGATGGTCTATACTGTGAATGCTCTTAAAAACTTGGGCATTGAACCAAATACTCCCATGTTTATGCATGCTCTTAGAGTGATGTTACAAACGAGCGA CCCCACTCGGAAGAAGAAAGTTGGAGTGTTGAAGAGTTTGGGTTGGACTGAGGAGGAAATTTTAAAGGATTTTAAGCATGATCGCCTTATTTTGGGATGT TCAGAGGAGAAGATCAGGGATGTCATGGATTTTTTTGCGGGTACCTTGAGATTGAAACCTCAAACTGTTATTACGAACTCCTGGTTCCTTCATTACTCAA TTGATAAAAGGCTCCGTCCAAGGTACAATGTTTTGAAGACTTTGAAGTCAAAGAACCCGATTGATGGGGACATCAGGATTGCGTGGCTGTTAACATCATT GAGTGAGAAGAAATTCTCGGAAAACTTTGTTACTAAGTATGCAGACAATGTCCCAGGTTTATTAGATTTTCTGCAATGTGGTTAG
AA sequence Show only first row Show all	>Potri.001G035600.2 pacid=42793463 polypeptide=Potri.001G035600.2.p locus=Potri.001G035600 ID=Potri.001G035600.2.v4.1 annot-version=v4.1 MQPNIDLLIKEGVTFDRVAKLIISQPGAIQQKHSRMVYTVNALKNLGIEPNTPMFMHALRVMLQTSDPTRKKKVGVLKSLGWTEEEILKDFKHDRLILGC SEEKIRDVMDFFAGTLRLKPQTVITNSWFLHYSIDKRLRPRYNVLKTLKSKNPIDGDIRIAWLLTSLSEKKFSENFVTKYADNVPGLLDFLQCG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G21150			Mitochondrial transcription te...		Potri.001G035600 [exp]	0	1
AT5G44070		ATPCS1, ARA8, C...	CADMIUM SENSITIVE 1, ARABIDOPS...		Potri.014G195900 [exp]	1.41	0.8345
AT5G30495			Fcf2 pre-rRNA processing prote...		Potri.010G002100 [exp]	6.40	0.8389
AT5G51940		NRPE6A, NRPD6A,...	RNA polymerase Rpb6 (.1)		Potri.015G138800 [exp]	12.60	0.7663
AT1G79070			SNARE-associated protein-relat...		Potri.008G043200 [exp]	12.80	0.8234
AT3G18140			Transducin/WD40 repeat-like su...		Potri.016G052800 [exp]	15.29	0.8213
AT3G13160			Tetratricopeptide repeat (TPR)...		Potri.004G030000 [exp]	16.61	0.8221
AT1G15900			unknown protein		Potri.001G046900 [exp]	16.97	0.8216
AT1G04770			Tetratricopeptide repeat (TPR)...		Potri.001G050600 [exp]	17.32	0.7608
AT1G51580			RNA-binding KH domain-containi...		Potri.010G251700 [exp]	18.97	0.7753
AT4G12760			unknown protein		Potri.014G197700 [exp]	19.49	0.8205

Compare expression of checked genes

Potri.001G035600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.