Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43150 56 / 1e-11 unknown protein AT1G48330 36 / 0.0005 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G187500 [exp] 144 / 2e-46 AT5G43150 51 / 8e-10 unknown protein Potri.002G119700 [exp] 61 / 9e-14 AT5G43150 58 / 1e-12 unknown protein Potri.018G131900 [exp] 61 / 4e-13 ND / Potri.006G070200 [exp] 56 / 3e-11 ND / Potri.010G004000 [exp] 44 / 3e-07 AT1G48330 86 / 8e-24 unknown protein Potri.013G037800 [exp] 43 / 7e-07 AT5G43150 39 / 2e-05 unknown protein Potri.016G124300 [exp] 42 / 2e-06 ND / Potri.006G103800 [exp] 42 / 3e-06 ND / Potri.008G152200 [exp] 42 / 4e-06 AT5G43150 41 / 9e-06 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041628 [exp] 112 / 1e-33 AT5G43150 52 / 3e-10 unknown protein Lus10024091 [exp] 89 / 2e-23 ND 44 / 3e-05 Lus10002866 [exp] 41 / 7e-06 ND / Lus10004910 [exp] 40 / 1e-05 AT5G43150 45 / 1e-07 unknown protein Lus10010543 [exp] 40 / 1e-05 AT5G43150 45 / 1e-07 unknown protein Lus10012234 [exp] 40 / 3e-05 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G037400.1 pacid=42788311 polypeptide=Potri.001G037400.1.p locus=Potri.001G037400 ID=Potri.001G037400.1.v4.1 annot-version=v4.1 ATGGATTTGTGGCATAAGATGATCTTCCCTGTTAGGAGAGTTTGGCTTTCTGTTTCTGCTCGTGTCAAAGCTCGCAAAAATGGTGCTAATCTTCTGAAGC TTCACAATGATGTACAGACATGTGGATATGAAGATGTGCAAGTGATGTGGGAAATTCTAAGGAGATCGGAATCAGAGCTGATGGCAAGTCATCCAAAGCG CAAGCAACGGCCTTTTTGGAGAGTTTTTGTATGGTCTAACCACAGTGCAGCCTCATCCTTCTCTGCAAATCACTCCTGA
AA sequence Show only first row Show all	>Potri.001G037400.1 pacid=42788311 polypeptide=Potri.001G037400.1.p locus=Potri.001G037400 ID=Potri.001G037400.1.v4.1 annot-version=v4.1 MDLWHKMIFPVRRVWLSVSARVKARKNGANLLKLHNDVQTCGYEDVQVMWEILRRSESELMASHPKRKQRPFWRVFVWSNHSAASSFSANHS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G43150			unknown protein		Potri.001G037400 [exp]	0	1
AT3G07970		QRT2	QUARTET 2, Pectin lyase-like s...		Potri.006G052700 [exp]	5.65	0.8788
AT4G33565			RING/U-box superfamily protein...		Potri.007G111900 [exp]	6.32	0.8316
AT3G49060			U-box domain-containing protei...		Potri.012G143100 [exp]	8.00	0.8047
AT4G05000		VPS28-2, VPS28-...	vacuolar protein sorting-assoc...		Potri.011G043800 [exp]	10.00	0.7793
AT4G10150			RING/U-box superfamily protein...		Potri.014G076800 [exp]	10.39	0.8631
AT5G20260			Exostosin family protein (.1)		Potri.006G064850 [exp]	13.56	0.7822
AT3G25280			Major facilitator superfamily ...		Potri.002G249100 [exp]	13.96	0.8194
AT4G32870			Polyketide cyclase/dehydrase a...		Potri.006G237100 [exp]	14.17	0.8351
AT2G38400		AGT3	alanine:glyoxylate aminotransf...		Potri.016G132200 [exp]	19.18	0.7928	AGT3.1
AT1G14590			Nucleotide-diphospho-sugar tra...		Potri.015G029200 [exp]	19.44	0.7945

Compare expression of checked genes

Potri.001G037400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.