Potri.001G040400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G22250 254 / 2e-84 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44260 251 / 2e-83 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G10960 239 / 6e-79 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 239 / 9e-79 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT2G32070 224 / 9e-73 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 215 / 2e-69 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT1G06450 157 / 1e-45 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 134 / 1e-37 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44240 126 / 2e-35 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 127 / 9e-35 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G186300 417 / 2e-148 AT5G22250 261 / 9e-87 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G038500 382 / 5e-136 AT5G22250 213 / 7e-69 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 270 / 8e-91 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 267 / 6e-90 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G205600 265 / 1e-88 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 261 / 4e-87 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 236 / 2e-77 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.018G020900 234 / 1e-76 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G262500 233 / 3e-76 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034180 270 / 6e-91 AT5G22250 410 / 4e-146 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10021304 262 / 2e-87 AT5G22250 335 / 8e-116 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10016980 258 / 4e-85 AT5G22250 332 / 8e-114 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10004212 254 / 1e-84 AT3G44260 336 / 1e-116 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017123 234 / 6e-77 AT2G32070 447 / 1e-160 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10018330 234 / 1e-76 AT2G32070 444 / 3e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10003635 230 / 3e-75 AT2G32070 435 / 6e-156 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10036291 224 / 6e-73 AT2G32070 432 / 9e-155 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 134 / 3e-37 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10001651 134 / 1e-36 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Potri.001G040400.1 pacid=42792759 polypeptide=Potri.001G040400.1.p locus=Potri.001G040400 ID=Potri.001G040400.1.v4.1 annot-version=v4.1
ATGAAGAGCAACAAACCAGTACATCTGCGCGAAGTCTGGGCAGACAACCTCGTATATGAGTTTTTTCTAATCAAGGAAGCGATCTCTCGCTTCCCCTTGG
TTGCTTTGGACACAGAATTCCTTGGTACTGTCTTTCAATTAAATCGTGACAAAAGTTCGCTGTCTCATGCCACTCCCTATGAAAACTACCGTCTCATGAA
GTGGAATGTTGATCTCTTGAAAATAATTCAACTTGGGATGACTCTTTCTGATTCACATGGAAATCTTCCAAGTTTGGGAACAGAATTCCACTATGCGTGG
CAGTTTAATTTCCGGGATTTCAATATCAAGCACGATCATCACAATGAAGAGTCTATTGGGTTACTTGAACGCCAAGGTATTGATTTGAAGAAGAACAGAG
AGAAGGGTATTGATTCCTCAGATTTTGGAAGGCTGATTTTGAGTTCTGGACTTGTTTCCAATAATTCTTCAATAACTTGGATTACTTTTCATGGCGCTTA
TGATTTTGGATTCTTGATCAAGATTTTAACTAAACGAGAGTTGCCAAGTGATATGCGGTCTTTTTTGGGGATGATGAGGTTTTTCTTTGGGGTTCGAGTT
TATGACACAAAATTCATGATGGGATGCATTAGTGGCTTGCACGGTGGATTGGAGAGGGTGGCCATGTTACTTGGTGTTGAACGAATAACGGGAAGAAGGC
ACCAGGCAGGATCTGATAGCTTGTTAACTCTTCAAACATTCGTGAGATTCAAGGATAGTCGTGTGCTAAAATTGATCTCGAGAAATTGA
AA sequence
>Potri.001G040400.1 pacid=42792759 polypeptide=Potri.001G040400.1.p locus=Potri.001G040400 ID=Potri.001G040400.1.v4.1 annot-version=v4.1
MKSNKPVHLREVWADNLVYEFFLIKEAISRFPLVALDTEFLGTVFQLNRDKSSLSHATPYENYRLMKWNVDLLKIIQLGMTLSDSHGNLPSLGTEFHYAW
QFNFRDFNIKHDHHNEESIGLLERQGIDLKKNREKGIDSSDFGRLILSSGLVSNNSSITWITFHGAYDFGFLIKILTKRELPSDMRSFLGMMRFFFGVRV
YDTKFMMGCISGLHGGLERVAMLLGVERITGRRHQAGSDSLLTLQTFVRFKDSRVLKLISRN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G22250 AtCAF1b CCR4- associated factor 1b, Po... Potri.001G040400 0 1
AT1G33430 Galactosyltransferase family p... Potri.019G067300 54.49 0.5017
AT1G54850 HSP20-like chaperones superfam... Potri.013G024750 76.36 0.5419

Potri.001G040400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.